Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X4T4

Protein Details
Accession G2X4T4   
Localization Confidence High
Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDTPLKVRRKRRGRSLYNKIFEYHydrophilic
81-111QSKLRKIEKLLRQRKVPKPPKIQKIERGVEEHydrophilic
NLS Segment(s)
PositionSequence
8-13RRKRRG
77-104GRGRQSKLRKIEKLLRQRKVPKPPKIQK
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
KEGG vda:VDAG_05166  -  
Amino Acid Sequences MDTPLKVRRKRRGRSLYNKIFEYGEFFDMNITIIAQERASGDYEVFQPVRNDNWPPAMRDIRPEILHTGRPITPKCGRGRQSKLRKIEKLLRQRKVPKPPKIQKIERGVEEISLDRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.87
5 0.79
6 0.7
7 0.59
8 0.48
9 0.43
10 0.34
11 0.26
12 0.2
13 0.18
14 0.16
15 0.15
16 0.16
17 0.1
18 0.07
19 0.05
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.09
28 0.08
29 0.09
30 0.1
31 0.12
32 0.12
33 0.12
34 0.12
35 0.12
36 0.14
37 0.15
38 0.16
39 0.14
40 0.21
41 0.21
42 0.22
43 0.25
44 0.26
45 0.25
46 0.26
47 0.28
48 0.24
49 0.23
50 0.23
51 0.21
52 0.2
53 0.22
54 0.2
55 0.19
56 0.18
57 0.22
58 0.22
59 0.25
60 0.28
61 0.33
62 0.38
63 0.44
64 0.48
65 0.53
66 0.62
67 0.66
68 0.72
69 0.74
70 0.78
71 0.78
72 0.77
73 0.75
74 0.76
75 0.75
76 0.75
77 0.77
78 0.74
79 0.74
80 0.79
81 0.81
82 0.83
83 0.83
84 0.83
85 0.84
86 0.87
87 0.88
88 0.88
89 0.88
90 0.86
91 0.86
92 0.82
93 0.74
94 0.68
95 0.58
96 0.49
97 0.43