Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X036

Protein Details
Accession G2X036   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
201-225VTYNPTPKMNPAPKGKRRKVEHTPAHydrophilic
NLS Segment(s)
PositionSequence
212-219APKGKRRK
Subcellular Location(s) mito 12, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
KEGG vda:VDAG_03059  -  
Amino Acid Sequences MPSTTRPKLPQLATPVTGTFPSEAVFSVTTPMSARPMSCVDLPTKTPISPPTAYMDFLKSMSGTSPGAQRDTSEEETATTESLPSTATSEATDCSCKCEHQHKVPASAPAIPPSPFTRLPMSAPPNGDASFPSLKIPPSPAFSHVDSPMSATPMTARSPFSARSVHSVFDWDAALKARFAEKRKPTRTSVRHIREVVTRTVTYNPTPKMNPAPKGKRRKVEHTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.36
4 0.33
5 0.28
6 0.2
7 0.14
8 0.13
9 0.11
10 0.1
11 0.11
12 0.11
13 0.1
14 0.12
15 0.11
16 0.11
17 0.12
18 0.12
19 0.13
20 0.14
21 0.14
22 0.15
23 0.18
24 0.2
25 0.2
26 0.22
27 0.21
28 0.23
29 0.25
30 0.27
31 0.26
32 0.24
33 0.25
34 0.26
35 0.3
36 0.27
37 0.27
38 0.27
39 0.27
40 0.28
41 0.26
42 0.26
43 0.2
44 0.2
45 0.18
46 0.12
47 0.11
48 0.11
49 0.11
50 0.1
51 0.1
52 0.14
53 0.15
54 0.17
55 0.16
56 0.16
57 0.18
58 0.23
59 0.25
60 0.21
61 0.2
62 0.19
63 0.2
64 0.2
65 0.16
66 0.1
67 0.08
68 0.07
69 0.07
70 0.06
71 0.05
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.09
79 0.12
80 0.1
81 0.13
82 0.13
83 0.14
84 0.17
85 0.25
86 0.31
87 0.36
88 0.45
89 0.43
90 0.48
91 0.49
92 0.49
93 0.41
94 0.37
95 0.3
96 0.23
97 0.22
98 0.17
99 0.17
100 0.15
101 0.19
102 0.16
103 0.18
104 0.19
105 0.18
106 0.2
107 0.25
108 0.27
109 0.25
110 0.26
111 0.25
112 0.24
113 0.23
114 0.22
115 0.15
116 0.16
117 0.14
118 0.14
119 0.14
120 0.13
121 0.13
122 0.14
123 0.18
124 0.15
125 0.18
126 0.19
127 0.21
128 0.23
129 0.25
130 0.27
131 0.24
132 0.23
133 0.19
134 0.2
135 0.18
136 0.16
137 0.14
138 0.11
139 0.11
140 0.12
141 0.14
142 0.13
143 0.13
144 0.14
145 0.17
146 0.18
147 0.2
148 0.21
149 0.2
150 0.26
151 0.26
152 0.24
153 0.22
154 0.23
155 0.21
156 0.19
157 0.18
158 0.12
159 0.12
160 0.13
161 0.14
162 0.11
163 0.12
164 0.16
165 0.21
166 0.26
167 0.34
168 0.42
169 0.52
170 0.6
171 0.64
172 0.65
173 0.71
174 0.74
175 0.75
176 0.76
177 0.73
178 0.74
179 0.7
180 0.67
181 0.63
182 0.59
183 0.54
184 0.48
185 0.41
186 0.34
187 0.37
188 0.37
189 0.35
190 0.39
191 0.36
192 0.37
193 0.38
194 0.41
195 0.47
196 0.52
197 0.55
198 0.59
199 0.67
200 0.71
201 0.8
202 0.84
203 0.84
204 0.84
205 0.86