Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WQ41

Protein Details
Accession G2WQ41    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-92VVVGEDGKRRRRRRRDNPPEIKDGIBasic
NLS Segment(s)
PositionSequence
75-83KRRRRRRRD
Subcellular Location(s) nucl 8mito 8mito_nucl 8, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG vda:VDAG_00483  -  
Amino Acid Sequences MPRRALQDAAPCRSQQAQVEPRTCSQTPRSRMTSSLFATTVVASFFVVGLPHILPCPAPRVAYADGEVVVGEDGKRRRRRRRDNPPEIKDGIVHFDQTPDTAAVSCSKDDRASRECPVPRPGGMLGEWLGFHAEKKVDQRTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.37
4 0.4
5 0.46
6 0.5
7 0.5
8 0.49
9 0.52
10 0.48
11 0.43
12 0.44
13 0.45
14 0.48
15 0.52
16 0.55
17 0.49
18 0.52
19 0.51
20 0.49
21 0.42
22 0.38
23 0.31
24 0.26
25 0.25
26 0.22
27 0.18
28 0.11
29 0.09
30 0.06
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.1
44 0.1
45 0.1
46 0.1
47 0.15
48 0.16
49 0.17
50 0.17
51 0.13
52 0.13
53 0.12
54 0.11
55 0.07
56 0.05
57 0.05
58 0.04
59 0.07
60 0.1
61 0.19
62 0.28
63 0.37
64 0.48
65 0.59
66 0.7
67 0.78
68 0.86
69 0.9
70 0.92
71 0.94
72 0.89
73 0.84
74 0.74
75 0.63
76 0.53
77 0.42
78 0.34
79 0.24
80 0.2
81 0.14
82 0.13
83 0.13
84 0.12
85 0.13
86 0.09
87 0.09
88 0.08
89 0.09
90 0.11
91 0.12
92 0.13
93 0.13
94 0.14
95 0.17
96 0.19
97 0.25
98 0.26
99 0.3
100 0.33
101 0.4
102 0.43
103 0.44
104 0.48
105 0.46
106 0.41
107 0.4
108 0.37
109 0.31
110 0.27
111 0.25
112 0.2
113 0.17
114 0.16
115 0.13
116 0.14
117 0.12
118 0.12
119 0.13
120 0.14
121 0.17
122 0.24