Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166QGD6

Protein Details
Accession A0A166QGD6   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
368-388EEPAPKKGKAAPKGRKKAAPABasic
NLS Segment(s)
PositionSequence
209-264AKGKKRARKSAAADDEEEEKPKAKRTKKAATKAEDEDEKPKPKAKRGKAAAAATVK
272-311DEKPKPKAKRGKAAAAAKAKDAEEEEAPKPKRGSRKSAVK
323-346APKPKRGAAKKVAAPKKAAPKKAK
371-403APKKGKAAPKGRKKAAPAAEEKPKSTRASRSRK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.666, mito 8, cyto_mito 7.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0016301  F:kinase activity  
GO:0008270  F:zinc ion binding  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF00645  zf-PARP  
Amino Acid Sequences HPSTSNQRPPRDQIPSFPCSHPLSPSSCFFLLPTSTLLTSFRSILRRSISCSNTVVKMPDYRIAHFETEVSPNNRAGCTDGVCKKAAAKCLKGSLRFGTWTKIMDHESFKWKHWGCVSGEQMAHVKELCEKEDGTFDFDAFDGYDEMGDHPDLQAKIRKAIEQGHIDPEDFNGDPWMNKTGQRGIRGKKPKDWDDGENGEEAEEEEAPAKGKKRARKSAAADDEEEEKPKAKRTKKAATKAEDEDEKPKPKAKRGKAAAAATVKAESEEEEDEKPKPKAKRGKAAAAAKAKDAEEEEAPKPKRGSRKSAVKEESDSAVEEEEAPKPKRGAAKKVAAPKKAAPKKAKVEESEEEPEAEVTPVSEAEEEEEPAPKKGKAAPKGRKKAAPAAEEKPKSTRASRSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.62
4 0.56
5 0.53
6 0.49
7 0.49
8 0.43
9 0.4
10 0.39
11 0.39
12 0.4
13 0.4
14 0.35
15 0.33
16 0.29
17 0.28
18 0.25
19 0.22
20 0.22
21 0.18
22 0.18
23 0.18
24 0.19
25 0.18
26 0.18
27 0.19
28 0.21
29 0.24
30 0.26
31 0.3
32 0.36
33 0.35
34 0.39
35 0.46
36 0.44
37 0.42
38 0.44
39 0.42
40 0.38
41 0.38
42 0.35
43 0.29
44 0.31
45 0.3
46 0.34
47 0.33
48 0.32
49 0.33
50 0.34
51 0.33
52 0.28
53 0.27
54 0.23
55 0.25
56 0.3
57 0.29
58 0.28
59 0.29
60 0.3
61 0.29
62 0.26
63 0.24
64 0.2
65 0.2
66 0.26
67 0.29
68 0.3
69 0.31
70 0.31
71 0.33
72 0.34
73 0.4
74 0.38
75 0.38
76 0.39
77 0.48
78 0.53
79 0.5
80 0.5
81 0.46
82 0.42
83 0.41
84 0.39
85 0.34
86 0.3
87 0.29
88 0.26
89 0.26
90 0.26
91 0.25
92 0.29
93 0.29
94 0.36
95 0.36
96 0.37
97 0.43
98 0.4
99 0.41
100 0.39
101 0.41
102 0.36
103 0.42
104 0.42
105 0.37
106 0.37
107 0.34
108 0.33
109 0.28
110 0.25
111 0.16
112 0.14
113 0.15
114 0.16
115 0.16
116 0.16
117 0.16
118 0.16
119 0.2
120 0.21
121 0.19
122 0.18
123 0.16
124 0.15
125 0.14
126 0.14
127 0.09
128 0.09
129 0.06
130 0.05
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.06
137 0.06
138 0.1
139 0.1
140 0.12
141 0.17
142 0.17
143 0.22
144 0.23
145 0.24
146 0.23
147 0.28
148 0.32
149 0.32
150 0.33
151 0.32
152 0.32
153 0.3
154 0.28
155 0.23
156 0.19
157 0.14
158 0.12
159 0.09
160 0.09
161 0.09
162 0.1
163 0.12
164 0.11
165 0.12
166 0.15
167 0.2
168 0.24
169 0.3
170 0.36
171 0.37
172 0.46
173 0.54
174 0.55
175 0.54
176 0.58
177 0.56
178 0.57
179 0.57
180 0.5
181 0.47
182 0.46
183 0.4
184 0.33
185 0.28
186 0.2
187 0.16
188 0.13
189 0.08
190 0.05
191 0.04
192 0.04
193 0.05
194 0.06
195 0.07
196 0.09
197 0.14
198 0.19
199 0.26
200 0.35
201 0.45
202 0.5
203 0.57
204 0.61
205 0.66
206 0.68
207 0.63
208 0.55
209 0.47
210 0.45
211 0.37
212 0.32
213 0.22
214 0.18
215 0.17
216 0.23
217 0.3
218 0.32
219 0.39
220 0.47
221 0.57
222 0.64
223 0.73
224 0.74
225 0.72
226 0.71
227 0.66
228 0.61
229 0.54
230 0.46
231 0.42
232 0.4
233 0.39
234 0.35
235 0.38
236 0.38
237 0.43
238 0.51
239 0.54
240 0.58
241 0.6
242 0.67
243 0.68
244 0.65
245 0.62
246 0.54
247 0.47
248 0.37
249 0.31
250 0.23
251 0.16
252 0.14
253 0.09
254 0.09
255 0.1
256 0.11
257 0.12
258 0.14
259 0.16
260 0.21
261 0.22
262 0.26
263 0.29
264 0.36
265 0.45
266 0.51
267 0.59
268 0.61
269 0.67
270 0.7
271 0.72
272 0.71
273 0.69
274 0.62
275 0.53
276 0.49
277 0.4
278 0.33
279 0.27
280 0.21
281 0.16
282 0.2
283 0.21
284 0.27
285 0.29
286 0.32
287 0.33
288 0.35
289 0.43
290 0.45
291 0.53
292 0.54
293 0.63
294 0.67
295 0.75
296 0.75
297 0.68
298 0.65
299 0.58
300 0.51
301 0.41
302 0.34
303 0.24
304 0.2
305 0.17
306 0.14
307 0.13
308 0.15
309 0.21
310 0.22
311 0.25
312 0.25
313 0.28
314 0.36
315 0.42
316 0.47
317 0.49
318 0.56
319 0.59
320 0.69
321 0.74
322 0.68
323 0.66
324 0.63
325 0.66
326 0.65
327 0.68
328 0.65
329 0.67
330 0.73
331 0.78
332 0.78
333 0.71
334 0.7
335 0.65
336 0.64
337 0.6
338 0.51
339 0.42
340 0.35
341 0.31
342 0.25
343 0.21
344 0.14
345 0.08
346 0.08
347 0.08
348 0.08
349 0.08
350 0.07
351 0.1
352 0.12
353 0.13
354 0.13
355 0.18
356 0.19
357 0.21
358 0.24
359 0.22
360 0.24
361 0.3
362 0.39
363 0.43
364 0.53
365 0.6
366 0.69
367 0.79
368 0.84
369 0.83
370 0.79
371 0.8
372 0.77
373 0.75
374 0.71
375 0.69
376 0.71
377 0.68
378 0.65
379 0.6
380 0.58
381 0.55
382 0.54
383 0.56