Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166YVG5

Protein Details
Accession A0A166YVG5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-72AAAQDKKPRRVPRPRPQHATPHydrophilic
NLS Segment(s)
PositionSequence
57-66KKPRRVPRPR
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MKLSLKKKFFAKEVNSPETAKASEPGKTADSTIAKTASAGKTSVAGKIASAAAAQDKKPRRVPRPRPQHATPLDTADDDNYDDCWLPEYEDPRPTDKLVDDGWVSVKKPASGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.56
4 0.51
5 0.44
6 0.38
7 0.29
8 0.24
9 0.2
10 0.21
11 0.21
12 0.22
13 0.21
14 0.2
15 0.2
16 0.21
17 0.22
18 0.2
19 0.21
20 0.19
21 0.17
22 0.17
23 0.21
24 0.17
25 0.16
26 0.15
27 0.13
28 0.15
29 0.16
30 0.17
31 0.13
32 0.11
33 0.1
34 0.11
35 0.11
36 0.08
37 0.07
38 0.06
39 0.08
40 0.09
41 0.1
42 0.16
43 0.2
44 0.25
45 0.32
46 0.4
47 0.46
48 0.56
49 0.67
50 0.7
51 0.78
52 0.81
53 0.82
54 0.77
55 0.77
56 0.7
57 0.64
58 0.55
59 0.47
60 0.39
61 0.32
62 0.29
63 0.2
64 0.16
65 0.12
66 0.11
67 0.09
68 0.08
69 0.08
70 0.08
71 0.1
72 0.09
73 0.11
74 0.14
75 0.16
76 0.2
77 0.25
78 0.27
79 0.29
80 0.31
81 0.3
82 0.3
83 0.27
84 0.27
85 0.23
86 0.24
87 0.2
88 0.19
89 0.23
90 0.22
91 0.22
92 0.23
93 0.25