Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166W381

Protein Details
Accession A0A166W381   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-59WRDIHPTKQARKKRKLSPKAAVGHydrophilic
NLS Segment(s)
PositionSequence
44-54KQARKKRKLSP
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_mito 4.833
Family & Domain DBs
Amino Acid Sequences MIDNFEALNGGSTTLSDHGRRMDMLALFLRFIKIMLWRDIHPTKQARKKRKLSPKAAVGLSHSDTFKYHDGSDDNTNENDSQSDERRWSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.13
4 0.14
5 0.16
6 0.17
7 0.17
8 0.17
9 0.18
10 0.16
11 0.17
12 0.18
13 0.16
14 0.15
15 0.15
16 0.14
17 0.1
18 0.1
19 0.08
20 0.11
21 0.14
22 0.16
23 0.18
24 0.19
25 0.26
26 0.28
27 0.28
28 0.29
29 0.32
30 0.37
31 0.45
32 0.53
33 0.56
34 0.64
35 0.72
36 0.76
37 0.81
38 0.83
39 0.82
40 0.82
41 0.79
42 0.74
43 0.67
44 0.57
45 0.49
46 0.42
47 0.36
48 0.3
49 0.22
50 0.18
51 0.17
52 0.2
53 0.2
54 0.18
55 0.16
56 0.18
57 0.19
58 0.23
59 0.29
60 0.28
61 0.28
62 0.26
63 0.28
64 0.25
65 0.24
66 0.2
67 0.17
68 0.2
69 0.22
70 0.26