Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166TLJ8

Protein Details
Accession A0A166TLJ8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGAKEHQRKRRCQQNVLLDRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MGAKEHQRKRRCQQNVLLDRAGRAVGTWNEKTAWFKKAGSQAPSSSGGYKAVPNLGPTVLDSGMMLTVSVCRAGRCVATESGLERGREGKRLVAQGCRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.79
4 0.73
5 0.62
6 0.54
7 0.46
8 0.37
9 0.25
10 0.17
11 0.15
12 0.15
13 0.2
14 0.2
15 0.21
16 0.21
17 0.23
18 0.28
19 0.26
20 0.25
21 0.22
22 0.21
23 0.25
24 0.33
25 0.37
26 0.35
27 0.35
28 0.33
29 0.33
30 0.36
31 0.31
32 0.24
33 0.19
34 0.17
35 0.14
36 0.14
37 0.11
38 0.11
39 0.1
40 0.1
41 0.1
42 0.09
43 0.09
44 0.08
45 0.1
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.03
54 0.04
55 0.04
56 0.06
57 0.06
58 0.06
59 0.08
60 0.09
61 0.1
62 0.12
63 0.15
64 0.15
65 0.16
66 0.17
67 0.18
68 0.23
69 0.26
70 0.23
71 0.21
72 0.26
73 0.26
74 0.31
75 0.3
76 0.3
77 0.32
78 0.39
79 0.42
80 0.43