Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166USW2

Protein Details
Accession A0A166USW2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
48-71IVVGEDGRRRRRKRREATPEIKDGBasic
NLS Segment(s)
PositionSequence
55-63RRRRRKRRE
Subcellular Location(s) mito 17, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Amino Acid Sequences MPPHPLHPRSRMTSSLFATTVVASFFVVGMPHLLPCPAPRVTYADGEIVVGEDGRRRRRKRREATPEIKDGIVSFDQVSDEETIRAREERLKRECPVPKPGGILGEWLGLHGPSKEAGPTKAER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.41
4 0.34
5 0.31
6 0.26
7 0.2
8 0.14
9 0.11
10 0.07
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.07
22 0.08
23 0.12
24 0.12
25 0.12
26 0.13
27 0.18
28 0.2
29 0.21
30 0.22
31 0.18
32 0.17
33 0.16
34 0.15
35 0.1
36 0.07
37 0.06
38 0.04
39 0.07
40 0.12
41 0.2
42 0.3
43 0.35
44 0.45
45 0.56
46 0.67
47 0.74
48 0.81
49 0.83
50 0.85
51 0.88
52 0.82
53 0.76
54 0.66
55 0.56
56 0.45
57 0.34
58 0.26
59 0.18
60 0.13
61 0.09
62 0.08
63 0.08
64 0.08
65 0.09
66 0.08
67 0.08
68 0.08
69 0.09
70 0.1
71 0.11
72 0.12
73 0.12
74 0.18
75 0.25
76 0.33
77 0.39
78 0.44
79 0.45
80 0.53
81 0.6
82 0.57
83 0.6
84 0.55
85 0.5
86 0.48
87 0.46
88 0.4
89 0.32
90 0.29
91 0.21
92 0.19
93 0.17
94 0.14
95 0.13
96 0.11
97 0.11
98 0.09
99 0.09
100 0.08
101 0.09
102 0.13
103 0.16
104 0.18