Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A161YM81

Protein Details
Accession A0A161YM81    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
6-34PSWPKDKTKTGPPRSARQRCARRDKDASQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MLVPDPSWPKDKTKTGPPRSARQRCARRDKDASQSQGGGFLGDRGVDSRDIAPVSLALPAAETRICSTSAQLDGVSAMPFYALLSPISHTYEPVSVCLRRTPPAEGDPFFEGLTGETSWKSVDGGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.76
4 0.75
5 0.77
6 0.8
7 0.84
8 0.81
9 0.81
10 0.82
11 0.82
12 0.88
13 0.84
14 0.81
15 0.8
16 0.77
17 0.76
18 0.74
19 0.69
20 0.6
21 0.54
22 0.45
23 0.39
24 0.34
25 0.24
26 0.16
27 0.11
28 0.09
29 0.07
30 0.07
31 0.05
32 0.07
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.09
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.08
53 0.08
54 0.08
55 0.1
56 0.1
57 0.11
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.06
72 0.07
73 0.09
74 0.12
75 0.12
76 0.12
77 0.13
78 0.15
79 0.15
80 0.16
81 0.19
82 0.17
83 0.18
84 0.23
85 0.24
86 0.25
87 0.27
88 0.29
89 0.3
90 0.35
91 0.39
92 0.35
93 0.36
94 0.35
95 0.33
96 0.29
97 0.24
98 0.18
99 0.14
100 0.15
101 0.12
102 0.11
103 0.1
104 0.11
105 0.11
106 0.11
107 0.11