Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X3D2

Protein Details
Accession G2X3D2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
122-142ASDARLKTRKRHESYNRDGSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cysk 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
KEGG vda:VDAG_04917  -  
Pfam View protein in Pfam  
PF12796  Ank_2  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MAEMLETALWLPVSFLAASMLRDVTRMNPLWRFGHLEVVEKLLTAGADANAAAAGGDGRTALQAAAEGGHLEIINRLKAAGALSNLNTMLLPEEILAESFVDEKELVAKILLGVREREGGGASDARLKTRKRHESYNRDGSAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.1
5 0.1
6 0.11
7 0.12
8 0.1
9 0.11
10 0.11
11 0.11
12 0.17
13 0.19
14 0.22
15 0.24
16 0.28
17 0.29
18 0.3
19 0.34
20 0.28
21 0.34
22 0.31
23 0.32
24 0.28
25 0.29
26 0.27
27 0.21
28 0.2
29 0.12
30 0.11
31 0.07
32 0.07
33 0.04
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.06
68 0.07
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.08
75 0.06
76 0.06
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.05
91 0.07
92 0.08
93 0.08
94 0.07
95 0.07
96 0.07
97 0.1
98 0.12
99 0.11
100 0.12
101 0.13
102 0.15
103 0.15
104 0.15
105 0.13
106 0.12
107 0.13
108 0.13
109 0.13
110 0.18
111 0.18
112 0.22
113 0.28
114 0.3
115 0.37
116 0.46
117 0.56
118 0.55
119 0.66
120 0.73
121 0.78
122 0.85
123 0.86