Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166PWP9

Protein Details
Accession A0A166PWP9   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
227-254ADTTEGKEKTRRQRRNRSEKASKQSTVRHydrophilic
NLS Segment(s)
PositionSequence
235-246KTRRQRRNRSEK
Subcellular Location(s) nucl 10.5, cyto_nucl 9.833, cyto 8, cysk 6, cyto_mito 5.333
Family & Domain DBs
Amino Acid Sequences MSYETLNLSGLCFEALNTTVECSDRLAKHVAWDASSVGLLDQDGLADVCEDTCRQSLVDLRTRILGSCDSDTDTIQYSYLSFPATYIVDRYLYFYDVSCYKDSSSGNFCDTVVAGWRNETGGSEAHFCDDCWLGPMSVQLKSPIGFNEDRAEEFASLTRSCSVDTYATPTPMPYGETTATLGDVMTTVQASAKDTATATTTATEVTSAEDMMPSIYPLLEVGTAASADTTEGKEKTRRQRRNRSEKASKQSTVRQANPHAPGTSEDCLKYQSFLPFELVYRKADRGKKDLDDFGINGCRYTATKHGVSRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.11
5 0.12
6 0.13
7 0.14
8 0.14
9 0.15
10 0.21
11 0.2
12 0.23
13 0.26
14 0.25
15 0.29
16 0.36
17 0.34
18 0.28
19 0.28
20 0.25
21 0.21
22 0.21
23 0.16
24 0.09
25 0.08
26 0.07
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.09
39 0.1
40 0.1
41 0.1
42 0.12
43 0.18
44 0.24
45 0.32
46 0.31
47 0.31
48 0.34
49 0.34
50 0.33
51 0.29
52 0.24
53 0.19
54 0.19
55 0.2
56 0.19
57 0.19
58 0.19
59 0.18
60 0.18
61 0.14
62 0.13
63 0.12
64 0.1
65 0.1
66 0.11
67 0.1
68 0.08
69 0.07
70 0.09
71 0.1
72 0.1
73 0.1
74 0.11
75 0.11
76 0.11
77 0.14
78 0.13
79 0.13
80 0.13
81 0.12
82 0.14
83 0.14
84 0.17
85 0.15
86 0.15
87 0.15
88 0.18
89 0.19
90 0.2
91 0.22
92 0.21
93 0.22
94 0.21
95 0.21
96 0.17
97 0.17
98 0.13
99 0.13
100 0.12
101 0.11
102 0.11
103 0.11
104 0.11
105 0.1
106 0.1
107 0.08
108 0.07
109 0.09
110 0.1
111 0.1
112 0.11
113 0.11
114 0.11
115 0.11
116 0.11
117 0.09
118 0.09
119 0.1
120 0.08
121 0.08
122 0.11
123 0.11
124 0.12
125 0.12
126 0.11
127 0.12
128 0.12
129 0.13
130 0.1
131 0.13
132 0.12
133 0.13
134 0.15
135 0.15
136 0.14
137 0.15
138 0.15
139 0.11
140 0.11
141 0.11
142 0.1
143 0.1
144 0.1
145 0.1
146 0.09
147 0.09
148 0.1
149 0.1
150 0.09
151 0.09
152 0.14
153 0.14
154 0.14
155 0.14
156 0.14
157 0.13
158 0.12
159 0.13
160 0.08
161 0.1
162 0.1
163 0.1
164 0.11
165 0.11
166 0.1
167 0.09
168 0.08
169 0.05
170 0.05
171 0.04
172 0.03
173 0.03
174 0.03
175 0.04
176 0.05
177 0.06
178 0.08
179 0.08
180 0.09
181 0.09
182 0.09
183 0.1
184 0.1
185 0.09
186 0.08
187 0.08
188 0.08
189 0.07
190 0.07
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.05
201 0.05
202 0.04
203 0.04
204 0.04
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.05
216 0.07
217 0.1
218 0.11
219 0.14
220 0.21
221 0.29
222 0.4
223 0.5
224 0.59
225 0.67
226 0.77
227 0.86
228 0.91
229 0.93
230 0.92
231 0.93
232 0.92
233 0.91
234 0.88
235 0.8
236 0.74
237 0.72
238 0.72
239 0.69
240 0.65
241 0.62
242 0.6
243 0.64
244 0.63
245 0.58
246 0.48
247 0.41
248 0.38
249 0.36
250 0.33
251 0.29
252 0.25
253 0.23
254 0.25
255 0.24
256 0.23
257 0.22
258 0.24
259 0.23
260 0.23
261 0.26
262 0.24
263 0.26
264 0.3
265 0.29
266 0.27
267 0.29
268 0.32
269 0.37
270 0.42
271 0.46
272 0.47
273 0.52
274 0.55
275 0.58
276 0.58
277 0.54
278 0.52
279 0.46
280 0.45
281 0.45
282 0.38
283 0.32
284 0.27
285 0.25
286 0.22
287 0.25
288 0.27
289 0.26
290 0.32