Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166YBM5

Protein Details
Accession A0A166YBM5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-71YIHFATLKPEQKKKKEPKKGGKGGKKBasic
NLS Segment(s)
PositionSequence
55-71EQKKKKEPKKGGKGGKK
Subcellular Location(s) cyto 8, extr 7, plas 5, mito 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFRSIGATPEAVAVLNDQPILFTILLIVLLAVILQGVLLWYIHFATLKPEQKKKKEPKKGGKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.07
12 0.09
13 0.08
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.09
38 0.18
39 0.26
40 0.33
41 0.42
42 0.51
43 0.61
44 0.72
45 0.78
46 0.81
47 0.84
48 0.89
49 0.91
50 0.93
51 0.94