Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166XGN7

Protein Details
Accession A0A166XGN7   
Localization Confidence High
Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
103-123ALTPGKNKRRESFRPRRESLHBasic
388-409FELQRPRKTKRGVKLSKYNVEYHydrophilic
505-534QELRMPKPPPPAEPRKKRRRATDNGGEEEVBasic
NLS Segment(s)
PositionSequence
107-118GKNKRRESFRPR
510-524PKPPPPAEPRKKRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035425  CENP-T/H4_C  
IPR009072  Histone-fold  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF15511  CENP-T_C  
Amino Acid Sequences MSSPPLRTPLTARLANVAGADDDDPLFSPALDATTTPYRRAPNLDPPSSRASFRTPSNNPLRSSLRSSAYRGLSASGRRSVAAATTPHARAAYRTLDARRAAALTPGKNKRRESFRPRRESLHDVLRGLSRVVKHNTQPISSSSSPSDLGSRAPSASLPIRTVDGDRRSLAYGDDDDDDDELPIDRPRLSLPLDVEDDDEDDLVAPELSQIDENATIEFPRRAYTDQPSRMSMGSVRLSEYRNYDDLDDDGDDGGEGFFPGFEVGALDEEGGRDREESFDRAEDENLRRRTLASARESDFGFEVPVDADNQTTFMMAVEGQSSPARPLPEITDEQPSLNIASAYDEPNPPMDEDMGFGTSYYDLRSSTPVEPAEATELDDETKASAHFELQRPRKTKRGVKLSKYNVEYPSLPPAVVKRLANTFARSSGISKTKISPETLAEIQRASDWFFEQLGDDLSAYAKHAKRKTIDESDMLTLMRRQRQTNQTTTPFSLAHRYLPRELLQELRMPKPPPPAEPRKKRRRATDNGGEEEVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.32
4 0.24
5 0.17
6 0.15
7 0.15
8 0.11
9 0.1
10 0.1
11 0.1
12 0.11
13 0.11
14 0.09
15 0.09
16 0.08
17 0.09
18 0.09
19 0.08
20 0.12
21 0.22
22 0.24
23 0.26
24 0.3
25 0.33
26 0.36
27 0.42
28 0.44
29 0.45
30 0.53
31 0.58
32 0.56
33 0.57
34 0.61
35 0.56
36 0.52
37 0.44
38 0.41
39 0.38
40 0.41
41 0.47
42 0.44
43 0.51
44 0.6
45 0.63
46 0.59
47 0.6
48 0.6
49 0.54
50 0.58
51 0.53
52 0.5
53 0.47
54 0.5
55 0.51
56 0.47
57 0.44
58 0.37
59 0.34
60 0.33
61 0.34
62 0.34
63 0.31
64 0.29
65 0.28
66 0.28
67 0.26
68 0.23
69 0.22
70 0.19
71 0.17
72 0.22
73 0.23
74 0.24
75 0.24
76 0.22
77 0.2
78 0.23
79 0.25
80 0.22
81 0.27
82 0.28
83 0.34
84 0.35
85 0.34
86 0.3
87 0.27
88 0.25
89 0.26
90 0.29
91 0.28
92 0.37
93 0.45
94 0.51
95 0.57
96 0.62
97 0.63
98 0.67
99 0.72
100 0.74
101 0.75
102 0.79
103 0.82
104 0.8
105 0.79
106 0.76
107 0.72
108 0.67
109 0.65
110 0.57
111 0.48
112 0.46
113 0.42
114 0.36
115 0.3
116 0.27
117 0.2
118 0.23
119 0.28
120 0.31
121 0.32
122 0.38
123 0.4
124 0.38
125 0.38
126 0.33
127 0.36
128 0.32
129 0.32
130 0.26
131 0.25
132 0.25
133 0.23
134 0.23
135 0.15
136 0.16
137 0.15
138 0.15
139 0.13
140 0.13
141 0.12
142 0.14
143 0.17
144 0.17
145 0.16
146 0.16
147 0.17
148 0.17
149 0.2
150 0.23
151 0.23
152 0.24
153 0.24
154 0.25
155 0.24
156 0.24
157 0.22
158 0.17
159 0.14
160 0.13
161 0.14
162 0.12
163 0.11
164 0.11
165 0.11
166 0.09
167 0.08
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.09
174 0.09
175 0.12
176 0.13
177 0.15
178 0.16
179 0.18
180 0.2
181 0.19
182 0.19
183 0.16
184 0.15
185 0.12
186 0.11
187 0.07
188 0.06
189 0.05
190 0.05
191 0.04
192 0.03
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.08
205 0.09
206 0.08
207 0.09
208 0.1
209 0.12
210 0.15
211 0.22
212 0.3
213 0.36
214 0.38
215 0.37
216 0.37
217 0.36
218 0.33
219 0.27
220 0.22
221 0.18
222 0.16
223 0.16
224 0.17
225 0.18
226 0.19
227 0.2
228 0.19
229 0.18
230 0.18
231 0.17
232 0.15
233 0.14
234 0.13
235 0.11
236 0.08
237 0.07
238 0.06
239 0.06
240 0.05
241 0.05
242 0.03
243 0.03
244 0.02
245 0.02
246 0.02
247 0.03
248 0.02
249 0.02
250 0.03
251 0.03
252 0.03
253 0.04
254 0.04
255 0.04
256 0.04
257 0.05
258 0.05
259 0.05
260 0.05
261 0.05
262 0.08
263 0.09
264 0.11
265 0.11
266 0.12
267 0.14
268 0.14
269 0.15
270 0.18
271 0.2
272 0.27
273 0.28
274 0.28
275 0.25
276 0.25
277 0.28
278 0.28
279 0.31
280 0.27
281 0.3
282 0.31
283 0.33
284 0.32
285 0.29
286 0.25
287 0.18
288 0.14
289 0.09
290 0.07
291 0.05
292 0.06
293 0.06
294 0.06
295 0.06
296 0.05
297 0.06
298 0.06
299 0.06
300 0.05
301 0.04
302 0.05
303 0.04
304 0.05
305 0.05
306 0.05
307 0.06
308 0.06
309 0.07
310 0.08
311 0.1
312 0.1
313 0.1
314 0.11
315 0.12
316 0.17
317 0.19
318 0.2
319 0.22
320 0.22
321 0.22
322 0.21
323 0.19
324 0.15
325 0.13
326 0.11
327 0.06
328 0.08
329 0.09
330 0.11
331 0.12
332 0.12
333 0.12
334 0.14
335 0.15
336 0.12
337 0.12
338 0.11
339 0.09
340 0.09
341 0.1
342 0.09
343 0.08
344 0.08
345 0.08
346 0.08
347 0.08
348 0.08
349 0.07
350 0.07
351 0.08
352 0.11
353 0.14
354 0.14
355 0.18
356 0.18
357 0.18
358 0.18
359 0.18
360 0.19
361 0.15
362 0.15
363 0.11
364 0.11
365 0.11
366 0.1
367 0.1
368 0.07
369 0.07
370 0.07
371 0.07
372 0.07
373 0.1
374 0.16
375 0.22
376 0.31
377 0.39
378 0.47
379 0.51
380 0.55
381 0.6
382 0.64
383 0.66
384 0.66
385 0.7
386 0.71
387 0.75
388 0.82
389 0.82
390 0.81
391 0.77
392 0.72
393 0.63
394 0.57
395 0.49
396 0.41
397 0.4
398 0.32
399 0.27
400 0.23
401 0.23
402 0.25
403 0.28
404 0.26
405 0.22
406 0.25
407 0.3
408 0.32
409 0.33
410 0.29
411 0.27
412 0.28
413 0.26
414 0.24
415 0.27
416 0.3
417 0.29
418 0.29
419 0.32
420 0.37
421 0.39
422 0.4
423 0.35
424 0.32
425 0.35
426 0.36
427 0.34
428 0.28
429 0.25
430 0.23
431 0.23
432 0.21
433 0.17
434 0.14
435 0.13
436 0.14
437 0.14
438 0.14
439 0.12
440 0.13
441 0.13
442 0.12
443 0.11
444 0.09
445 0.1
446 0.09
447 0.1
448 0.17
449 0.19
450 0.27
451 0.31
452 0.38
453 0.42
454 0.49
455 0.57
456 0.58
457 0.59
458 0.54
459 0.54
460 0.5
461 0.46
462 0.39
463 0.32
464 0.27
465 0.29
466 0.33
467 0.33
468 0.35
469 0.43
470 0.53
471 0.59
472 0.64
473 0.66
474 0.65
475 0.67
476 0.65
477 0.59
478 0.51
479 0.45
480 0.44
481 0.37
482 0.38
483 0.39
484 0.42
485 0.42
486 0.45
487 0.46
488 0.42
489 0.42
490 0.39
491 0.35
492 0.36
493 0.37
494 0.38
495 0.41
496 0.4
497 0.42
498 0.47
499 0.49
500 0.51
501 0.56
502 0.63
503 0.67
504 0.77
505 0.83
506 0.84
507 0.91
508 0.91
509 0.92
510 0.91
511 0.91
512 0.9
513 0.89
514 0.87
515 0.83