Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166MR17

Protein Details
Accession A0A166MR17    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-36LTTATICKRRREPELRNTRQSRHGQHHKPKPNPLGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023580  RNA_pol_su_RPB10  
IPR020789  RNA_pol_suN_Zn-BS  
IPR000268  RPABC5/Rpb10  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF01194  RNA_pol_N  
PROSITE View protein in PROSITE  
PS01112  RNA_POL_N_8KD  
Amino Acid Sequences LTTATICKRRREPELRNTRQSRHGQHHKPKPNPLGLQYVSTPNKPAKMIIPVRCFSCGKVTGDLWERYLKLIDDGITDGDAMDQLGLKRYCCRRMVMTHVDLIEKLLKYTPDGRNEKKMSLNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.84
4 0.83
5 0.78
6 0.76
7 0.76
8 0.73
9 0.72
10 0.74
11 0.74
12 0.79
13 0.85
14 0.86
15 0.84
16 0.85
17 0.82
18 0.79
19 0.72
20 0.65
21 0.62
22 0.53
23 0.48
24 0.4
25 0.4
26 0.34
27 0.31
28 0.31
29 0.24
30 0.25
31 0.23
32 0.23
33 0.17
34 0.24
35 0.31
36 0.35
37 0.39
38 0.38
39 0.39
40 0.41
41 0.39
42 0.31
43 0.29
44 0.24
45 0.21
46 0.22
47 0.2
48 0.2
49 0.24
50 0.24
51 0.2
52 0.19
53 0.18
54 0.16
55 0.17
56 0.14
57 0.1
58 0.1
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.06
66 0.05
67 0.05
68 0.04
69 0.03
70 0.04
71 0.04
72 0.11
73 0.11
74 0.12
75 0.19
76 0.25
77 0.31
78 0.33
79 0.36
80 0.35
81 0.4
82 0.48
83 0.49
84 0.46
85 0.43
86 0.42
87 0.39
88 0.34
89 0.3
90 0.27
91 0.19
92 0.17
93 0.17
94 0.16
95 0.19
96 0.28
97 0.33
98 0.38
99 0.46
100 0.51
101 0.59
102 0.62
103 0.63