Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A161VRD7

Protein Details
Accession A0A161VRD7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
108-132KSEAGKPPPRPPRPEKPKWPPLLQRBasic
325-371VDTPEKKMERHKQFRMDFRTAKIERKAKRREKNKWRRVRGLEPAPVABasic
NLS Segment(s)
PositionSequence
100-126REKKLRDAKSEAGKPPPRPPRPEKPKW
339-364RMDFRTAKIERKAKRREKNKWRRVRG
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
Amino Acid Sequences MSPSQFIPARSSRHRVACIALYRALVREARAIPLPDDVLRKGTQNPIPRLVKKAFGRNRTETSYRIVFSALGTGYNFLNLFKAAQTPNSKEHSQIIAHLREKKLRDAKSEAGKPPPRPPRPEKPKWPPLLQRTSKDDEPPTYISPRFPVPRENLTGARRVPHVAITAEGIAFLRQKKLQDHSVALYVQQKTRIKRRTMDLLLSSMREDMPWAADEDRWEEIVKKEMQAARRQETWETRVRGERPVDQDRLAAGGREREVPDRLRQGESYGQMVTENWKFASKRLDDLMAQQAARAKAFVEIRKAEKEMLEKDNDTYLSRGHRWMVDTPEKKMERHKQFRMDFRTAKIERKAKRREKNKWRRVRGLEPAPVAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.55
3 0.54
4 0.53
5 0.52
6 0.49
7 0.44
8 0.38
9 0.35
10 0.34
11 0.33
12 0.26
13 0.22
14 0.25
15 0.23
16 0.25
17 0.28
18 0.29
19 0.26
20 0.27
21 0.28
22 0.24
23 0.27
24 0.25
25 0.25
26 0.24
27 0.25
28 0.26
29 0.33
30 0.36
31 0.42
32 0.46
33 0.51
34 0.58
35 0.59
36 0.62
37 0.56
38 0.58
39 0.55
40 0.61
41 0.6
42 0.61
43 0.66
44 0.66
45 0.68
46 0.67
47 0.64
48 0.55
49 0.53
50 0.48
51 0.41
52 0.35
53 0.3
54 0.23
55 0.2
56 0.22
57 0.16
58 0.12
59 0.12
60 0.12
61 0.11
62 0.12
63 0.12
64 0.08
65 0.09
66 0.08
67 0.09
68 0.08
69 0.13
70 0.13
71 0.19
72 0.24
73 0.28
74 0.33
75 0.38
76 0.38
77 0.35
78 0.38
79 0.36
80 0.31
81 0.33
82 0.33
83 0.35
84 0.39
85 0.44
86 0.43
87 0.45
88 0.46
89 0.5
90 0.52
91 0.49
92 0.5
93 0.5
94 0.54
95 0.57
96 0.62
97 0.57
98 0.58
99 0.6
100 0.58
101 0.61
102 0.65
103 0.62
104 0.63
105 0.68
106 0.69
107 0.74
108 0.8
109 0.81
110 0.81
111 0.84
112 0.82
113 0.82
114 0.79
115 0.78
116 0.79
117 0.74
118 0.69
119 0.66
120 0.65
121 0.59
122 0.55
123 0.49
124 0.4
125 0.39
126 0.37
127 0.32
128 0.31
129 0.29
130 0.25
131 0.24
132 0.27
133 0.26
134 0.24
135 0.27
136 0.28
137 0.32
138 0.35
139 0.36
140 0.37
141 0.35
142 0.39
143 0.33
144 0.31
145 0.27
146 0.24
147 0.21
148 0.17
149 0.17
150 0.13
151 0.13
152 0.11
153 0.11
154 0.09
155 0.09
156 0.07
157 0.06
158 0.07
159 0.08
160 0.09
161 0.11
162 0.13
163 0.16
164 0.2
165 0.24
166 0.25
167 0.27
168 0.26
169 0.26
170 0.24
171 0.23
172 0.24
173 0.2
174 0.18
175 0.23
176 0.26
177 0.28
178 0.37
179 0.43
180 0.42
181 0.45
182 0.48
183 0.51
184 0.49
185 0.49
186 0.41
187 0.37
188 0.34
189 0.3
190 0.26
191 0.17
192 0.14
193 0.1
194 0.09
195 0.06
196 0.06
197 0.06
198 0.08
199 0.08
200 0.08
201 0.09
202 0.11
203 0.12
204 0.11
205 0.11
206 0.11
207 0.11
208 0.16
209 0.17
210 0.15
211 0.19
212 0.21
213 0.25
214 0.31
215 0.35
216 0.34
217 0.36
218 0.37
219 0.36
220 0.38
221 0.39
222 0.4
223 0.37
224 0.36
225 0.39
226 0.39
227 0.41
228 0.39
229 0.4
230 0.4
231 0.43
232 0.43
233 0.38
234 0.37
235 0.31
236 0.3
237 0.24
238 0.18
239 0.13
240 0.14
241 0.14
242 0.17
243 0.18
244 0.19
245 0.22
246 0.24
247 0.29
248 0.33
249 0.34
250 0.33
251 0.32
252 0.33
253 0.34
254 0.33
255 0.29
256 0.22
257 0.19
258 0.17
259 0.17
260 0.18
261 0.15
262 0.15
263 0.13
264 0.18
265 0.18
266 0.21
267 0.29
268 0.26
269 0.28
270 0.3
271 0.32
272 0.28
273 0.32
274 0.36
275 0.3
276 0.28
277 0.25
278 0.27
279 0.25
280 0.25
281 0.21
282 0.14
283 0.17
284 0.22
285 0.24
286 0.27
287 0.3
288 0.34
289 0.38
290 0.39
291 0.35
292 0.34
293 0.36
294 0.35
295 0.36
296 0.36
297 0.34
298 0.34
299 0.36
300 0.34
301 0.29
302 0.24
303 0.22
304 0.24
305 0.25
306 0.27
307 0.26
308 0.27
309 0.29
310 0.33
311 0.39
312 0.43
313 0.44
314 0.46
315 0.53
316 0.53
317 0.51
318 0.57
319 0.59
320 0.59
321 0.66
322 0.71
323 0.71
324 0.77
325 0.85
326 0.83
327 0.82
328 0.75
329 0.7
330 0.71
331 0.64
332 0.64
333 0.64
334 0.64
335 0.63
336 0.69
337 0.75
338 0.75
339 0.83
340 0.86
341 0.87
342 0.9
343 0.94
344 0.94
345 0.94
346 0.94
347 0.94
348 0.92
349 0.9
350 0.89
351 0.87
352 0.84