Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166RIA2

Protein Details
Accession A0A166RIA2   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
374-396KDNSTYGKTKKKIKETTNKFIGDHydrophilic
435-459GAPLRLFPSKRPRVRLNRQPNTLFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, mito_nucl 12.833, cyto_mito 12.333, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018306  Phage_T5_Orf172_DNA-bd  
Pfam View protein in Pfam  
PF10544  T5orf172  
Amino Acid Sequences MRLRGFCKKCFVALIYGLGHPVCLQRGYFSFSSFPYLTKPSGRLLFELCAMSVSSLSGQSRPINDDYNSKVNLVTLHTAATTPTMAPRHDKSTGGERLEVSVSVKTVTDAVSIMAITATRQADDNDNPGNGAANTMQRIIGVGQVRLPGQRPLQDDAGLPLKINKSFNPKAEEGRGVVYVLEHEAKTGLFKIGYTQNMLNRSSNCKKSKPKLIYETPGGPFVAAWKAKSLARTALSYHNLKITECQLCGWGHDDWFDAPKDLVLETVRAMETFVQLPAYESKNGKEWVLTVAAEEMIKSMGEFSLEGLKSSIKSTEEHPADKTATVPVMQPSQESVTCVSETSLLPSPLTSEEDSEETRFTATPEASNVGKDAKDNSTYGKTKKKIKETTNKFIGDVGGFMGSLLDRSQDNTPERVKTKNLTGRRTGDVTDAGMGAPLRLFPSKRPRVRLNRQPNTLFLGQDVEHRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.33
3 0.31
4 0.3
5 0.25
6 0.22
7 0.17
8 0.17
9 0.14
10 0.14
11 0.14
12 0.16
13 0.19
14 0.25
15 0.24
16 0.25
17 0.25
18 0.24
19 0.31
20 0.27
21 0.26
22 0.24
23 0.28
24 0.29
25 0.31
26 0.32
27 0.32
28 0.38
29 0.39
30 0.36
31 0.35
32 0.34
33 0.32
34 0.3
35 0.24
36 0.18
37 0.17
38 0.15
39 0.11
40 0.1
41 0.08
42 0.11
43 0.12
44 0.12
45 0.15
46 0.18
47 0.21
48 0.25
49 0.26
50 0.28
51 0.29
52 0.34
53 0.36
54 0.39
55 0.38
56 0.34
57 0.31
58 0.27
59 0.27
60 0.25
61 0.22
62 0.16
63 0.15
64 0.15
65 0.15
66 0.14
67 0.14
68 0.11
69 0.09
70 0.13
71 0.15
72 0.17
73 0.22
74 0.25
75 0.3
76 0.32
77 0.33
78 0.32
79 0.38
80 0.44
81 0.41
82 0.4
83 0.34
84 0.34
85 0.33
86 0.3
87 0.22
88 0.16
89 0.14
90 0.12
91 0.12
92 0.1
93 0.1
94 0.1
95 0.09
96 0.08
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06
102 0.05
103 0.05
104 0.09
105 0.09
106 0.09
107 0.1
108 0.11
109 0.16
110 0.17
111 0.21
112 0.19
113 0.19
114 0.19
115 0.18
116 0.18
117 0.13
118 0.13
119 0.1
120 0.1
121 0.11
122 0.12
123 0.12
124 0.1
125 0.11
126 0.1
127 0.13
128 0.12
129 0.11
130 0.12
131 0.14
132 0.15
133 0.15
134 0.16
135 0.16
136 0.17
137 0.22
138 0.24
139 0.26
140 0.27
141 0.27
142 0.26
143 0.24
144 0.26
145 0.21
146 0.17
147 0.17
148 0.18
149 0.2
150 0.21
151 0.22
152 0.27
153 0.31
154 0.36
155 0.38
156 0.38
157 0.39
158 0.4
159 0.39
160 0.31
161 0.28
162 0.24
163 0.18
164 0.16
165 0.12
166 0.09
167 0.09
168 0.09
169 0.07
170 0.07
171 0.07
172 0.07
173 0.08
174 0.08
175 0.08
176 0.06
177 0.06
178 0.1
179 0.13
180 0.14
181 0.16
182 0.17
183 0.2
184 0.23
185 0.25
186 0.24
187 0.22
188 0.3
189 0.34
190 0.4
191 0.42
192 0.46
193 0.54
194 0.59
195 0.67
196 0.66
197 0.67
198 0.67
199 0.68
200 0.65
201 0.59
202 0.57
203 0.47
204 0.41
205 0.33
206 0.25
207 0.18
208 0.15
209 0.17
210 0.12
211 0.12
212 0.11
213 0.13
214 0.14
215 0.16
216 0.16
217 0.14
218 0.15
219 0.16
220 0.17
221 0.21
222 0.23
223 0.24
224 0.23
225 0.22
226 0.21
227 0.2
228 0.2
229 0.19
230 0.17
231 0.16
232 0.16
233 0.16
234 0.15
235 0.16
236 0.17
237 0.13
238 0.11
239 0.11
240 0.11
241 0.09
242 0.11
243 0.11
244 0.09
245 0.08
246 0.08
247 0.08
248 0.08
249 0.08
250 0.07
251 0.07
252 0.07
253 0.08
254 0.08
255 0.07
256 0.08
257 0.07
258 0.08
259 0.08
260 0.08
261 0.07
262 0.06
263 0.08
264 0.11
265 0.12
266 0.14
267 0.15
268 0.16
269 0.2
270 0.21
271 0.19
272 0.17
273 0.15
274 0.14
275 0.15
276 0.14
277 0.09
278 0.09
279 0.09
280 0.09
281 0.08
282 0.06
283 0.05
284 0.05
285 0.04
286 0.04
287 0.04
288 0.04
289 0.05
290 0.05
291 0.12
292 0.12
293 0.13
294 0.13
295 0.14
296 0.14
297 0.15
298 0.16
299 0.1
300 0.11
301 0.14
302 0.23
303 0.25
304 0.26
305 0.27
306 0.28
307 0.28
308 0.27
309 0.25
310 0.17
311 0.15
312 0.14
313 0.14
314 0.13
315 0.15
316 0.15
317 0.14
318 0.14
319 0.17
320 0.16
321 0.16
322 0.16
323 0.15
324 0.15
325 0.15
326 0.14
327 0.13
328 0.13
329 0.16
330 0.18
331 0.16
332 0.16
333 0.16
334 0.17
335 0.16
336 0.19
337 0.15
338 0.13
339 0.14
340 0.17
341 0.18
342 0.18
343 0.17
344 0.14
345 0.14
346 0.13
347 0.12
348 0.14
349 0.13
350 0.13
351 0.15
352 0.17
353 0.17
354 0.17
355 0.17
356 0.15
357 0.15
358 0.15
359 0.17
360 0.18
361 0.2
362 0.2
363 0.24
364 0.3
365 0.35
366 0.4
367 0.46
368 0.49
369 0.56
370 0.65
371 0.7
372 0.72
373 0.77
374 0.82
375 0.82
376 0.86
377 0.84
378 0.77
379 0.67
380 0.58
381 0.5
382 0.39
383 0.3
384 0.2
385 0.12
386 0.1
387 0.09
388 0.08
389 0.06
390 0.06
391 0.06
392 0.06
393 0.06
394 0.09
395 0.13
396 0.2
397 0.23
398 0.28
399 0.32
400 0.38
401 0.4
402 0.42
403 0.44
404 0.42
405 0.5
406 0.54
407 0.58
408 0.58
409 0.63
410 0.64
411 0.64
412 0.62
413 0.53
414 0.47
415 0.4
416 0.34
417 0.27
418 0.23
419 0.17
420 0.16
421 0.14
422 0.11
423 0.1
424 0.09
425 0.1
426 0.15
427 0.16
428 0.23
429 0.35
430 0.45
431 0.53
432 0.61
433 0.69
434 0.75
435 0.85
436 0.88
437 0.88
438 0.87
439 0.88
440 0.83
441 0.76
442 0.72
443 0.63
444 0.53
445 0.42
446 0.36
447 0.28