Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166UDA3

Protein Details
Accession A0A166UDA3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-89FTSGPRKGRPKKISQVEKRKSGLHydrophilic
NLS Segment(s)
PositionSequence
70-86GPRKGRPKKISQVEKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR013249  RNA_pol_sigma70_r4_t2  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016987  F:sigma factor activity  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF08281  Sigma70_r4_2  
Amino Acid Sequences MDAQLQEFTSVISGDRRTNDELSEIQRVAITAFVLAGRSYREAARAFNCSLGAVHKTLRRFNASKTFTSGPRKGRPKKISQVEKRKSGLQKSTTGHPIESSLGKGREGEPQGLNTAKLALRRVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.23
4 0.26
5 0.27
6 0.26
7 0.25
8 0.26
9 0.27
10 0.29
11 0.25
12 0.21
13 0.21
14 0.2
15 0.17
16 0.14
17 0.1
18 0.05
19 0.06
20 0.05
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.09
28 0.13
29 0.13
30 0.16
31 0.18
32 0.2
33 0.2
34 0.19
35 0.19
36 0.16
37 0.15
38 0.14
39 0.13
40 0.1
41 0.12
42 0.14
43 0.17
44 0.19
45 0.21
46 0.25
47 0.25
48 0.28
49 0.35
50 0.36
51 0.34
52 0.36
53 0.36
54 0.36
55 0.42
56 0.43
57 0.4
58 0.46
59 0.56
60 0.59
61 0.67
62 0.69
63 0.7
64 0.74
65 0.78
66 0.8
67 0.8
68 0.84
69 0.8
70 0.81
71 0.74
72 0.72
73 0.68
74 0.64
75 0.62
76 0.55
77 0.56
78 0.51
79 0.54
80 0.53
81 0.48
82 0.41
83 0.33
84 0.31
85 0.26
86 0.24
87 0.21
88 0.21
89 0.21
90 0.21
91 0.22
92 0.21
93 0.27
94 0.29
95 0.3
96 0.26
97 0.27
98 0.31
99 0.3
100 0.29
101 0.22
102 0.22
103 0.2
104 0.21