FuNGI

A0A161VJ72

Protein Details

Accession

A0A161VJ72

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
58-77	APTPSKTKAGRQPKPTSKLI	Hydrophilic

NLS Segment(s)

Position	Sequence
65-71	KAGRQPK

Subcellular Location(s)

nucl 17, mito_nucl 12.666, cyto_nucl 11.666, mito 6

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0003743 F:translation initiation factor activity GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MPDISAPPPRPKLKLSVGSRQASFSEQNGATPSASTPSSSMKIKLKSSQPPTPAGPAAPTPSKTKAGRQPKPTSKLIESKKREQDEDDDGTNQPSKKIKLLKTPTVSTPRTGHIVVKSKGKPPVHPPGDGYDSEASDQEKDPTIEEQFILRMMPGEHCEYVRKCIEEGKVGIPRKDGGADILMKFFDDESRRAMVVVKGQPYAAVMVELPTITEGMKSWDRKTFMKSADICHMLLVFQQVRSEDEAKKAPLPAMIQPGFKWPHGLTPPMHDATNQRFAKIISRSEIELKENEVKKLLQADAAAMSSRYELVDDRKMQSGDEYSEDEQDADGEADDSGYFPADGYNDGELEHDEDLEAELMAAFEEEEAMNQATTEVGTPATQLEGATPMTMNTGTPAPNAHDSGDGEESVASEEDEDDDDDDDDDDKERVDEVKAVREDIAQLKNEIAKKEQEKSNQTNKILRNRVEARLKDLRAELSLKQASIGEQEEDED

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.64
2	0.63
3	0.64
4	0.68
5	0.69
6	0.66
7	0.6
8	0.51
9	0.46
10	0.41
11	0.32
12	0.32
13	0.27
14	0.27
15	0.28
16	0.28
17	0.24
18	0.22
19	0.21
20	0.16
21	0.16
22	0.16
23	0.15
24	0.18
25	0.22
26	0.24
27	0.29
28	0.34
29	0.39
30	0.44
31	0.49
32	0.53
33	0.58
34	0.64
35	0.66
36	0.63
37	0.62
38	0.61
39	0.58
40	0.51
41	0.42
42	0.37
43	0.31
44	0.33
45	0.32
46	0.31
47	0.31
48	0.34
49	0.4
50	0.4
51	0.46
52	0.51
53	0.57
54	0.63
55	0.68
56	0.75
57	0.77
58	0.82
59	0.78
60	0.75
61	0.71
62	0.72
63	0.72
64	0.71
65	0.69
66	0.72
67	0.76
68	0.74
69	0.69
70	0.64
71	0.6
72	0.57
73	0.54
74	0.46
75	0.39
76	0.35
77	0.35
78	0.36
79	0.3
80	0.26
81	0.27
82	0.27
83	0.32
84	0.4
85	0.44
86	0.5
87	0.58
88	0.63
89	0.64
90	0.65
91	0.66
92	0.66
93	0.61
94	0.55
95	0.49
96	0.42
97	0.4
98	0.37
99	0.33
100	0.32
101	0.4
102	0.38
103	0.45
104	0.46
105	0.47
106	0.54
107	0.53
108	0.51
109	0.49
110	0.58
111	0.52
112	0.5
113	0.47
114	0.44
115	0.46
116	0.4
117	0.37
118	0.27
119	0.24
120	0.23
121	0.22
122	0.17
123	0.15
124	0.16
125	0.14
126	0.14
127	0.14
128	0.15
129	0.16
130	0.17
131	0.16
132	0.15
133	0.14
134	0.12
135	0.12
136	0.11
137	0.08
138	0.08
139	0.08
140	0.09
141	0.11
142	0.13
143	0.14
144	0.15
145	0.2
146	0.2
147	0.24
148	0.26
149	0.24
150	0.22
151	0.26
152	0.28
153	0.27
154	0.28
155	0.28
156	0.33
157	0.34
158	0.35
159	0.31
160	0.29
161	0.25
162	0.24
163	0.19
164	0.12
165	0.13
166	0.15
167	0.14
168	0.14
169	0.13
170	0.12
171	0.12
172	0.11
173	0.12
174	0.12
175	0.12
176	0.14
177	0.16
178	0.16
179	0.17
180	0.18
181	0.16
182	0.2
183	0.23
184	0.22
185	0.21
186	0.2
187	0.2
188	0.19
189	0.18
190	0.11
191	0.07
192	0.05
193	0.05
194	0.05
195	0.05
196	0.05
197	0.04
198	0.04
199	0.04
200	0.04
201	0.04
202	0.08
203	0.13
204	0.15
205	0.17
206	0.21
207	0.24
208	0.26
209	0.3
210	0.33
211	0.3
212	0.35
213	0.35
214	0.33
215	0.35
216	0.35
217	0.31
218	0.24
219	0.22
220	0.15
221	0.14
222	0.14
223	0.1
224	0.08
225	0.09
226	0.09
227	0.1
228	0.13
229	0.16
230	0.14
231	0.16
232	0.18
233	0.18
234	0.19
235	0.19
236	0.16
237	0.15
238	0.15
239	0.15
240	0.2
241	0.2
242	0.2
243	0.19
244	0.25
245	0.25
246	0.23
247	0.23
248	0.16
249	0.2
250	0.21
251	0.24
252	0.19
253	0.22
254	0.26
255	0.24
256	0.24
257	0.19
258	0.22
259	0.24
260	0.33
261	0.29
262	0.25
263	0.25
264	0.25
265	0.31
266	0.3
267	0.27
268	0.2
269	0.21
270	0.22
271	0.25
272	0.26
273	0.22
274	0.19
275	0.21
276	0.26
277	0.26
278	0.26
279	0.23
280	0.22
281	0.21
282	0.23
283	0.2
284	0.14
285	0.12
286	0.13
287	0.12
288	0.12
289	0.11
290	0.08
291	0.07
292	0.06
293	0.06
294	0.06
295	0.05
296	0.06
297	0.1
298	0.17
299	0.19
300	0.21
301	0.24
302	0.25
303	0.24
304	0.24
305	0.22
306	0.18
307	0.17
308	0.19
309	0.16
310	0.17
311	0.17
312	0.15
313	0.13
314	0.11
315	0.1
316	0.07
317	0.06
318	0.05
319	0.05
320	0.05
321	0.05
322	0.05
323	0.04
324	0.04
325	0.04
326	0.04
327	0.05
328	0.05
329	0.06
330	0.07
331	0.08
332	0.08
333	0.08
334	0.09
335	0.08
336	0.1
337	0.09
338	0.07
339	0.06
340	0.06
341	0.07
342	0.07
343	0.06
344	0.04
345	0.04
346	0.04
347	0.04
348	0.04
349	0.03
350	0.03
351	0.04
352	0.04
353	0.04
354	0.06
355	0.06
356	0.06
357	0.06
358	0.06
359	0.06
360	0.06
361	0.06
362	0.05
363	0.05
364	0.05
365	0.06
366	0.06
367	0.07
368	0.07
369	0.06
370	0.06
371	0.08
372	0.08
373	0.08
374	0.08
375	0.08
376	0.09
377	0.09
378	0.08
379	0.08
380	0.1
381	0.1
382	0.1
383	0.12
384	0.14
385	0.17
386	0.18
387	0.18
388	0.18
389	0.18
390	0.21
391	0.22
392	0.18
393	0.15
394	0.14
395	0.13
396	0.12
397	0.11
398	0.07
399	0.06
400	0.06
401	0.07
402	0.08
403	0.09
404	0.08
405	0.09
406	0.09
407	0.09
408	0.1
409	0.09
410	0.09
411	0.1
412	0.09
413	0.09
414	0.09
415	0.1
416	0.11
417	0.11
418	0.16
419	0.17
420	0.26
421	0.26
422	0.27
423	0.27
424	0.26
425	0.29
426	0.3
427	0.33
428	0.26
429	0.26
430	0.27
431	0.32
432	0.34
433	0.33
434	0.3
435	0.34
436	0.38
437	0.45
438	0.5
439	0.54
440	0.59
441	0.66
442	0.73
443	0.73
444	0.73
445	0.72
446	0.73
447	0.75
448	0.74
449	0.68
450	0.68
451	0.65
452	0.69
453	0.7
454	0.65
455	0.62
456	0.63
457	0.61
458	0.55
459	0.52
460	0.46
461	0.4
462	0.41
463	0.34
464	0.34
465	0.36
466	0.31
467	0.29
468	0.28
469	0.25
470	0.26
471	0.26
472	0.19

A0A161VJ72

3D AlphaFold-predicted Structure Viewer