Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150VAD5

Protein Details
Accession A0A150VAD5    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
234-256EVVNRRPRGRPAKQMSLKKPPIPHydrophilic
NLS Segment(s)
PositionSequence
75-88IRKAVNRAVNKKTK
123-131QKSHKRGKK
197-258DKAAASIAKKKAAADAKVIRKATREVLKAQKPREKESEVVNRRPRGRPAKQMSLKKPPIPPR
Subcellular Location(s) mito 13, nucl 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MSKKDFFKLFWLAWQKAFTEANIKSSWKKTGLVPWCPSVVLNKLRQQPVRNEVHLGRLSSSPPIDWDSPTAKRSIRKAVNRAVNKKTKKLLSKLTEELLSTKAQLTLAKIEKKKVFEALRTAQKSHKRGKKLIEEFRASEGSGAIVFSPTKVRKLLNLQKAREQAKEQQKVNKALKHQQAIAARELKAQEAQQKKDDKAAASIAKKKAAADAKVIRKATREVLKAQKPREKESEVVNRRPRGRPAKQMSLKKPPIPPRQPLAQIPPNQQSSRSGRTIKRPAHLLGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.37
4 0.37
5 0.29
6 0.29
7 0.28
8 0.29
9 0.3
10 0.32
11 0.33
12 0.36
13 0.41
14 0.35
15 0.36
16 0.36
17 0.43
18 0.49
19 0.52
20 0.52
21 0.49
22 0.47
23 0.45
24 0.41
25 0.35
26 0.34
27 0.32
28 0.35
29 0.39
30 0.46
31 0.53
32 0.58
33 0.59
34 0.6
35 0.62
36 0.62
37 0.57
38 0.54
39 0.48
40 0.51
41 0.48
42 0.41
43 0.34
44 0.28
45 0.27
46 0.25
47 0.25
48 0.17
49 0.16
50 0.19
51 0.19
52 0.18
53 0.21
54 0.23
55 0.27
56 0.28
57 0.29
58 0.28
59 0.32
60 0.36
61 0.42
62 0.46
63 0.51
64 0.57
65 0.62
66 0.68
67 0.72
68 0.74
69 0.73
70 0.74
71 0.7
72 0.69
73 0.67
74 0.65
75 0.64
76 0.63
77 0.64
78 0.6
79 0.62
80 0.58
81 0.53
82 0.47
83 0.4
84 0.35
85 0.26
86 0.21
87 0.15
88 0.13
89 0.11
90 0.11
91 0.11
92 0.11
93 0.16
94 0.21
95 0.28
96 0.29
97 0.34
98 0.37
99 0.39
100 0.39
101 0.39
102 0.36
103 0.32
104 0.37
105 0.38
106 0.43
107 0.42
108 0.43
109 0.42
110 0.47
111 0.5
112 0.53
113 0.53
114 0.51
115 0.54
116 0.6
117 0.64
118 0.65
119 0.68
120 0.65
121 0.61
122 0.55
123 0.53
124 0.46
125 0.35
126 0.26
127 0.18
128 0.11
129 0.08
130 0.07
131 0.04
132 0.04
133 0.04
134 0.04
135 0.1
136 0.1
137 0.12
138 0.14
139 0.14
140 0.17
141 0.27
142 0.36
143 0.4
144 0.48
145 0.47
146 0.52
147 0.58
148 0.57
149 0.5
150 0.44
151 0.44
152 0.46
153 0.52
154 0.49
155 0.5
156 0.54
157 0.6
158 0.62
159 0.57
160 0.51
161 0.53
162 0.56
163 0.52
164 0.46
165 0.43
166 0.43
167 0.41
168 0.41
169 0.36
170 0.3
171 0.29
172 0.29
173 0.24
174 0.21
175 0.2
176 0.24
177 0.27
178 0.29
179 0.34
180 0.39
181 0.38
182 0.42
183 0.43
184 0.36
185 0.32
186 0.34
187 0.34
188 0.34
189 0.41
190 0.37
191 0.38
192 0.37
193 0.35
194 0.37
195 0.36
196 0.33
197 0.33
198 0.39
199 0.44
200 0.5
201 0.51
202 0.45
203 0.42
204 0.43
205 0.43
206 0.42
207 0.37
208 0.38
209 0.47
210 0.55
211 0.59
212 0.65
213 0.63
214 0.6
215 0.64
216 0.64
217 0.58
218 0.52
219 0.54
220 0.57
221 0.59
222 0.64
223 0.66
224 0.66
225 0.68
226 0.71
227 0.71
228 0.7
229 0.71
230 0.72
231 0.72
232 0.76
233 0.79
234 0.84
235 0.82
236 0.83
237 0.82
238 0.78
239 0.78
240 0.78
241 0.8
242 0.77
243 0.76
244 0.71
245 0.72
246 0.71
247 0.68
248 0.67
249 0.64
250 0.63
251 0.63
252 0.65
253 0.63
254 0.58
255 0.54
256 0.52
257 0.52
258 0.51
259 0.51
260 0.52
261 0.52
262 0.61
263 0.7
264 0.69
265 0.68
266 0.66