Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V5Q3

Protein Details
Accession A0A150V5Q3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MATKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
Subcellular Location(s) mito 16, nucl 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEGQVTLRTRKFIRNPLLGRKQMVVDVLHPGRPNVSKDELRGKLGELYKIKKDQVSVFGFRTQYGGGKSTGFALLYDSDEAMKKFEPHYRLVRYGMATKIEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.65
4 0.71
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.2
14 0.24
15 0.23
16 0.24
17 0.23
18 0.22
19 0.23
20 0.25
21 0.26
22 0.23
23 0.27
24 0.27
25 0.3
26 0.39
27 0.38
28 0.37
29 0.35
30 0.31
31 0.31
32 0.3
33 0.33
34 0.27
35 0.29
36 0.32
37 0.34
38 0.34
39 0.3
40 0.3
41 0.27
42 0.3
43 0.31
44 0.29
45 0.28
46 0.3
47 0.29
48 0.27
49 0.25
50 0.18
51 0.15
52 0.13
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.07
66 0.07
67 0.08
68 0.08
69 0.09
70 0.09
71 0.09
72 0.11
73 0.16
74 0.19
75 0.23
76 0.3
77 0.34
78 0.36
79 0.37
80 0.37
81 0.34
82 0.35
83 0.32
84 0.3
85 0.27
86 0.25
87 0.29
88 0.28
89 0.28
90 0.32
91 0.4
92 0.46
93 0.55
94 0.64
95 0.69
96 0.78
97 0.87
98 0.91
99 0.92
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.63
113 0.62
114 0.63