Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JIW9

Protein Details
Accession G3JIW9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-57ARCFETLSCRRRRRRWCARHQPATTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
KEGG cmt:CCM_06123  -  
Amino Acid Sequences MCHLHFGTHPCGCRDESRIVVCDRVVHHVADARCFETLSCRRRRRRWCARHQPATTYTTSSRSPTPHPRPGPAAWEYERPEYDIYGRYHHSSYFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.34
4 0.35
5 0.36
6 0.35
7 0.34
8 0.3
9 0.29
10 0.25
11 0.25
12 0.23
13 0.2
14 0.19
15 0.23
16 0.23
17 0.23
18 0.23
19 0.18
20 0.16
21 0.16
22 0.15
23 0.19
24 0.26
25 0.31
26 0.4
27 0.48
28 0.56
29 0.66
30 0.76
31 0.78
32 0.82
33 0.85
34 0.86
35 0.89
36 0.9
37 0.9
38 0.82
39 0.76
40 0.68
41 0.61
42 0.5
43 0.42
44 0.33
45 0.27
46 0.26
47 0.23
48 0.23
49 0.22
50 0.28
51 0.35
52 0.43
53 0.49
54 0.51
55 0.53
56 0.55
57 0.54
58 0.53
59 0.44
60 0.42
61 0.35
62 0.39
63 0.38
64 0.38
65 0.37
66 0.33
67 0.32
68 0.27
69 0.27
70 0.27
71 0.26
72 0.25
73 0.28
74 0.29
75 0.3
76 0.3