Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150UT43

Protein Details
Accession A0A150UT43   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
30-55KYSHKVAPRIRKPRDIKSRTKHTPARBasic
NLS Segment(s)
PositionSequence
22-53KQVRSRAAKYSHKVAPRIRKPRDIKSRTKHTP
Subcellular Location(s) nucl 23.5, cyto_nucl 13.833, mito_nucl 13.166
Family & Domain DBs
Amino Acid Sequences MVESSDLVFVNVSSDRQESIRKQVRSRAAKYSHKVAPRIRKPRDIKSRTKHTPARPDPPSGFISARQLSEDSRTVLNIRTQKECAEDEDAGQETDEEVSSVWSRHKITRTPKLLNSLVKPQSADPFESYPVPAEPYFAQVLHHSQYIKLSKSLETD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.22
5 0.23
6 0.33
7 0.42
8 0.44
9 0.47
10 0.54
11 0.62
12 0.65
13 0.66
14 0.65
15 0.64
16 0.68
17 0.69
18 0.69
19 0.65
20 0.61
21 0.64
22 0.62
23 0.65
24 0.66
25 0.72
26 0.7
27 0.74
28 0.74
29 0.78
30 0.81
31 0.78
32 0.78
33 0.77
34 0.82
35 0.79
36 0.81
37 0.79
38 0.76
39 0.79
40 0.76
41 0.75
42 0.67
43 0.66
44 0.58
45 0.54
46 0.47
47 0.38
48 0.32
49 0.24
50 0.27
51 0.23
52 0.22
53 0.18
54 0.17
55 0.15
56 0.17
57 0.18
58 0.13
59 0.12
60 0.12
61 0.12
62 0.13
63 0.17
64 0.19
65 0.2
66 0.21
67 0.22
68 0.22
69 0.24
70 0.23
71 0.21
72 0.2
73 0.18
74 0.15
75 0.16
76 0.16
77 0.13
78 0.12
79 0.1
80 0.06
81 0.06
82 0.06
83 0.04
84 0.04
85 0.05
86 0.06
87 0.07
88 0.08
89 0.11
90 0.14
91 0.18
92 0.23
93 0.29
94 0.37
95 0.47
96 0.53
97 0.56
98 0.57
99 0.6
100 0.6
101 0.58
102 0.53
103 0.52
104 0.48
105 0.43
106 0.41
107 0.36
108 0.37
109 0.34
110 0.33
111 0.26
112 0.25
113 0.26
114 0.26
115 0.25
116 0.2
117 0.19
118 0.2
119 0.16
120 0.17
121 0.15
122 0.18
123 0.19
124 0.17
125 0.18
126 0.16
127 0.21
128 0.2
129 0.23
130 0.2
131 0.19
132 0.27
133 0.32
134 0.32
135 0.31
136 0.31