Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V7P5

Protein Details
Accession A0A150V7P5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-56DRPPASSPRHVRRRPPPPPDDBasic
NLS Segment(s)
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013860  AreA_GATA  
Pfam View protein in Pfam  
PF08550  DUF1752  
Amino Acid Sequences MLDEGDGLSLETSKAAMETTASSLSPAARPNDDDHDRPPASSPRHVRRRPPPPPDDPASAASSAIQSLTSASTLSSGPPAALDLSSPLFPSWRDGASAGLPPSDESAEEMQKNDPLGTQMWKLYHKTKAQLPNAERLENLTWRMMSMNLRRKELARQQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.08
6 0.1
7 0.11
8 0.11
9 0.11
10 0.12
11 0.13
12 0.15
13 0.17
14 0.17
15 0.18
16 0.2
17 0.23
18 0.31
19 0.34
20 0.34
21 0.33
22 0.38
23 0.37
24 0.35
25 0.36
26 0.35
27 0.35
28 0.41
29 0.47
30 0.49
31 0.59
32 0.64
33 0.69
34 0.72
35 0.78
36 0.8
37 0.8
38 0.77
39 0.73
40 0.74
41 0.7
42 0.64
43 0.56
44 0.49
45 0.41
46 0.34
47 0.27
48 0.21
49 0.16
50 0.12
51 0.09
52 0.06
53 0.04
54 0.04
55 0.05
56 0.05
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.12
83 0.13
84 0.15
85 0.12
86 0.11
87 0.1
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.11
94 0.14
95 0.14
96 0.15
97 0.15
98 0.16
99 0.17
100 0.14
101 0.12
102 0.11
103 0.12
104 0.14
105 0.15
106 0.16
107 0.18
108 0.21
109 0.25
110 0.28
111 0.34
112 0.36
113 0.39
114 0.45
115 0.52
116 0.56
117 0.61
118 0.59
119 0.61
120 0.6
121 0.56
122 0.48
123 0.43
124 0.39
125 0.33
126 0.33
127 0.25
128 0.22
129 0.21
130 0.22
131 0.21
132 0.25
133 0.31
134 0.39
135 0.41
136 0.45
137 0.47
138 0.48
139 0.55