Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150VIE6

Protein Details
Accession A0A150VIE6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-59NAMPRHPQQKGERRNRWRRQMGLPEQLHydrophilic
NLS Segment(s)
PositionSequence
29-50RKARNAMPRHPQQKGERRNRWR
Subcellular Location(s) mito 7, extr 6, plas 5, E.R. 4, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPGGIITTTIVTVCVVCAYGAYERVHEARKARNAMPRHPQQKGERRNRWRRQMGLPEQLYPLRPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.06
6 0.07
7 0.11
8 0.11
9 0.11
10 0.13
11 0.15
12 0.17
13 0.18
14 0.2
15 0.23
16 0.28
17 0.32
18 0.33
19 0.38
20 0.39
21 0.43
22 0.49
23 0.51
24 0.51
25 0.5
26 0.54
27 0.56
28 0.63
29 0.68
30 0.7
31 0.72
32 0.77
33 0.85
34 0.88
35 0.9
36 0.88
37 0.84
38 0.82
39 0.83
40 0.8
41 0.79
42 0.71
43 0.63
44 0.58
45 0.55