Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150UNM5

Protein Details
Accession A0A150UNM5   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-61IFNTPKATLRNRRARRRYRADYEANHydrophilic
NLS Segment(s)
PositionSequence
47-53NRRARRR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MSQQQHILALYTEANLQLAIASISSNQIPSVRRSVAIFNTPKATLRNRRARRRYRADYEANSKRLTKVEEERNAKPTGKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.05
5 0.05
6 0.05
7 0.04
8 0.04
9 0.04
10 0.06
11 0.06
12 0.06
13 0.06
14 0.09
15 0.1
16 0.13
17 0.17
18 0.17
19 0.17
20 0.18
21 0.21
22 0.2
23 0.26
24 0.25
25 0.21
26 0.23
27 0.22
28 0.23
29 0.23
30 0.27
31 0.29
32 0.38
33 0.47
34 0.55
35 0.65
36 0.74
37 0.82
38 0.86
39 0.87
40 0.86
41 0.83
42 0.82
43 0.79
44 0.75
45 0.75
46 0.73
47 0.66
48 0.59
49 0.52
50 0.46
51 0.42
52 0.38
53 0.35
54 0.36
55 0.43
56 0.51
57 0.56
58 0.58
59 0.59
60 0.6