Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UPN4

Protein Details
Accession A0A150UPN4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-49LEAAKKKPKKKATQQANATSHydrophilic
NLS Segment(s)
PositionSequence
34-40KKKPKKK
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.999, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLYSGSGLQMLNRFYKLTQEVLEIATQAELEAAKKKPKKKATQQANATSIENVQEEAIETVSSDSDDDCIFVAATRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.23
4 0.22
5 0.21
6 0.2
7 0.2
8 0.2
9 0.2
10 0.14
11 0.12
12 0.09
13 0.08
14 0.06
15 0.05
16 0.04
17 0.05
18 0.09
19 0.11
20 0.19
21 0.24
22 0.3
23 0.39
24 0.48
25 0.57
26 0.63
27 0.71
28 0.75
29 0.8
30 0.81
31 0.79
32 0.73
33 0.65
34 0.55
35 0.45
36 0.34
37 0.26
38 0.18
39 0.12
40 0.09
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07