Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UNY5

Protein Details
Accession A0A150UNY5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLTAKTRRRVQRNRHRKMQQQHIPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MLTAKTRRRVQRNRHRKMQQQHIPNLEIAEEIEEGIYKLAHSLKIHYITAALRKSRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.87
5 0.87
6 0.83
7 0.8
8 0.78
9 0.71
10 0.64
11 0.54
12 0.45
13 0.34
14 0.25
15 0.16
16 0.11
17 0.07
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.03
25 0.05
26 0.07
27 0.1
28 0.11
29 0.14
30 0.19
31 0.23
32 0.24
33 0.22
34 0.23
35 0.23
36 0.3
37 0.33