Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V2F5

Protein Details
Accession A0A150V2F5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-69AWTAKSTNRRLRRIKAPILIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MSAVIGQSGALVAKMLQRPGQRLLGCSRQQYLRFRAQQTSFSSPVQRSFAWTAKSTNRRLRRIKAPILI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.18
4 0.21
5 0.24
6 0.28
7 0.34
8 0.29
9 0.3
10 0.34
11 0.38
12 0.38
13 0.37
14 0.35
15 0.33
16 0.37
17 0.4
18 0.41
19 0.41
20 0.43
21 0.43
22 0.46
23 0.43
24 0.44
25 0.43
26 0.44
27 0.37
28 0.33
29 0.35
30 0.3
31 0.32
32 0.29
33 0.24
34 0.23
35 0.26
36 0.29
37 0.29
38 0.3
39 0.31
40 0.38
41 0.46
42 0.5
43 0.55
44 0.6
45 0.66
46 0.73
47 0.77
48 0.78
49 0.8