Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150VDV6

Protein Details
Accession A0A150VDV6    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
250-291VERFRGMKKRERDKAVERRKRRESQKERRRMPRDRRGTIEKVBasic
NLS Segment(s)
PositionSequence
208-214AKADKER
219-287LRQHRREEREKVKQGKTPYYLKEKELKERALVERFRGMKKRERDKAVERRKRRESQKERRRMPRDRRGT
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MASVSFGALKKAQEALSRKRKRGTDTNEEHEDKLEALRQRLRQIKAEKASSSARFKSRGQITPGMDGRDQVHRAESDLADKTGVEDDEEDDSESNRAPSEEDTAPSKARTSKHAPTAQSSRHQVSRKRTVVSVPKSTARDPRFDSILSYRSHSDNSNRYLANKAYAFLDDYQRSEIAELKAALQRTHSDDDRAVLRRKINSMENRLKAKADKERQQEVLRQHRREEREKVKQGKTPYYLKEKELKERALVERFRGMKKRERDKAVERRKRRESQKERRRMPRDRRGTIEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.51
4 0.6
5 0.63
6 0.68
7 0.71
8 0.71
9 0.74
10 0.73
11 0.72
12 0.72
13 0.74
14 0.75
15 0.72
16 0.64
17 0.55
18 0.47
19 0.36
20 0.3
21 0.28
22 0.23
23 0.25
24 0.32
25 0.34
26 0.42
27 0.49
28 0.51
29 0.54
30 0.56
31 0.6
32 0.61
33 0.62
34 0.54
35 0.51
36 0.54
37 0.52
38 0.53
39 0.49
40 0.46
41 0.45
42 0.45
43 0.5
44 0.52
45 0.51
46 0.5
47 0.52
48 0.5
49 0.54
50 0.55
51 0.49
52 0.41
53 0.36
54 0.32
55 0.31
56 0.3
57 0.23
58 0.23
59 0.2
60 0.21
61 0.23
62 0.21
63 0.19
64 0.19
65 0.19
66 0.16
67 0.16
68 0.15
69 0.14
70 0.13
71 0.09
72 0.08
73 0.09
74 0.11
75 0.12
76 0.11
77 0.09
78 0.1
79 0.1
80 0.1
81 0.09
82 0.07
83 0.07
84 0.07
85 0.08
86 0.13
87 0.13
88 0.15
89 0.18
90 0.19
91 0.2
92 0.19
93 0.21
94 0.2
95 0.2
96 0.25
97 0.29
98 0.33
99 0.41
100 0.46
101 0.46
102 0.47
103 0.52
104 0.5
105 0.48
106 0.46
107 0.4
108 0.42
109 0.46
110 0.46
111 0.48
112 0.55
113 0.53
114 0.5
115 0.48
116 0.48
117 0.52
118 0.51
119 0.48
120 0.4
121 0.41
122 0.41
123 0.43
124 0.45
125 0.37
126 0.36
127 0.34
128 0.33
129 0.31
130 0.28
131 0.28
132 0.22
133 0.25
134 0.21
135 0.2
136 0.19
137 0.18
138 0.19
139 0.19
140 0.22
141 0.23
142 0.26
143 0.28
144 0.27
145 0.27
146 0.29
147 0.27
148 0.26
149 0.21
150 0.18
151 0.14
152 0.15
153 0.15
154 0.13
155 0.18
156 0.15
157 0.15
158 0.16
159 0.15
160 0.15
161 0.14
162 0.16
163 0.12
164 0.13
165 0.13
166 0.13
167 0.16
168 0.17
169 0.16
170 0.14
171 0.15
172 0.17
173 0.21
174 0.2
175 0.2
176 0.19
177 0.21
178 0.25
179 0.28
180 0.27
181 0.27
182 0.29
183 0.3
184 0.32
185 0.35
186 0.38
187 0.41
188 0.47
189 0.52
190 0.55
191 0.56
192 0.55
193 0.53
194 0.48
195 0.47
196 0.48
197 0.48
198 0.5
199 0.53
200 0.57
201 0.61
202 0.61
203 0.6
204 0.59
205 0.61
206 0.62
207 0.58
208 0.59
209 0.61
210 0.64
211 0.66
212 0.67
213 0.66
214 0.68
215 0.75
216 0.78
217 0.76
218 0.74
219 0.74
220 0.72
221 0.68
222 0.64
223 0.61
224 0.62
225 0.59
226 0.58
227 0.6
228 0.56
229 0.6
230 0.6
231 0.56
232 0.5
233 0.53
234 0.55
235 0.55
236 0.52
237 0.46
238 0.46
239 0.48
240 0.52
241 0.53
242 0.52
243 0.53
244 0.61
245 0.68
246 0.7
247 0.73
248 0.75
249 0.77
250 0.83
251 0.86
252 0.86
253 0.85
254 0.86
255 0.88
256 0.89
257 0.9
258 0.9
259 0.9
260 0.9
261 0.92
262 0.92
263 0.93
264 0.94
265 0.93
266 0.92
267 0.92
268 0.92
269 0.91
270 0.88
271 0.86