Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UUU0

Protein Details
Accession A0A150UUU0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-69GNMVDCRRREPRRRSHHTFRFAVRBasic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 4, golg 3, mito 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLRQMRISVIAWTIFGLLFVIVIDSMDQGDIQDTPIEAGSFDETFGNMVDCRRREPRRRSHHTFRFAVRFDHVWSSADVRIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.05
5 0.05
6 0.04
7 0.04
8 0.03
9 0.04
10 0.04
11 0.03
12 0.04
13 0.04
14 0.04
15 0.03
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.06
32 0.06
33 0.06
34 0.05
35 0.07
36 0.12
37 0.12
38 0.17
39 0.26
40 0.35
41 0.44
42 0.54
43 0.63
44 0.69
45 0.78
46 0.83
47 0.86
48 0.87
49 0.85
50 0.8
51 0.77
52 0.74
53 0.66
54 0.59
55 0.52
56 0.45
57 0.39
58 0.39
59 0.33
60 0.26
61 0.26
62 0.27