Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150UW70

Protein Details
Accession A0A150UW70   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-93GMMGQRTNRKRIRHRPNRPWKTQNSQHydrophilic
NLS Segment(s)
PositionSequence
76-85RKRIRHRPNR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSHVAGNEVSEPNISHPHQCSDHAMSLVTYCRMLMAVSAKMSLRSGKYIDKSSLSYAKLSLQKITKNGMMGQRTNRKRIRHRPNRPWKTQNSQPITGTYASSPHADRWTSPSPYTTTFTNSYCWSGQKKYESEYRGSERISESAAQRELRIFGGLEGERDQSDLRSRMLDVVLGLFHGLDYEDAPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.26
4 0.31
5 0.32
6 0.34
7 0.37
8 0.36
9 0.38
10 0.34
11 0.31
12 0.26
13 0.25
14 0.25
15 0.2
16 0.14
17 0.1
18 0.1
19 0.1
20 0.09
21 0.09
22 0.11
23 0.12
24 0.12
25 0.14
26 0.14
27 0.15
28 0.16
29 0.17
30 0.15
31 0.16
32 0.18
33 0.23
34 0.27
35 0.3
36 0.31
37 0.3
38 0.3
39 0.32
40 0.34
41 0.29
42 0.26
43 0.23
44 0.27
45 0.29
46 0.28
47 0.29
48 0.27
49 0.29
50 0.31
51 0.33
52 0.29
53 0.25
54 0.27
55 0.28
56 0.28
57 0.29
58 0.34
59 0.41
60 0.43
61 0.5
62 0.52
63 0.55
64 0.61
65 0.69
66 0.73
67 0.74
68 0.82
69 0.84
70 0.9
71 0.91
72 0.9
73 0.87
74 0.82
75 0.78
76 0.74
77 0.73
78 0.67
79 0.6
80 0.52
81 0.45
82 0.4
83 0.33
84 0.27
85 0.17
86 0.13
87 0.12
88 0.12
89 0.12
90 0.11
91 0.13
92 0.13
93 0.13
94 0.19
95 0.23
96 0.24
97 0.24
98 0.25
99 0.24
100 0.27
101 0.28
102 0.22
103 0.21
104 0.21
105 0.22
106 0.22
107 0.21
108 0.21
109 0.21
110 0.23
111 0.23
112 0.24
113 0.28
114 0.32
115 0.32
116 0.33
117 0.39
118 0.38
119 0.38
120 0.41
121 0.41
122 0.38
123 0.37
124 0.35
125 0.3
126 0.28
127 0.26
128 0.23
129 0.19
130 0.21
131 0.25
132 0.23
133 0.22
134 0.22
135 0.22
136 0.2
137 0.19
138 0.14
139 0.11
140 0.16
141 0.15
142 0.16
143 0.16
144 0.16
145 0.15
146 0.16
147 0.16
148 0.13
149 0.2
150 0.2
151 0.2
152 0.2
153 0.21
154 0.23
155 0.22
156 0.21
157 0.15
158 0.14
159 0.12
160 0.11
161 0.1
162 0.07
163 0.06
164 0.06
165 0.06
166 0.05