Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UU89

Protein Details
Accession A0A150UU89    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-29QLLHTRKARKTGKRVALKGKFHydrophilic
NLS Segment(s)
PositionSequence
15-22KARKTGKR
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
Amino Acid Sequences RKRLAFAEQLLHTRKARKTGKRVALKGKFVFSTQEVLQIANEAEEAIAAKKRNKERQIQPITIEVENIEDEAPSSVSSECESDCIVVAARKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.53
4 0.57
5 0.62
6 0.68
7 0.75
8 0.78
9 0.81
10 0.82
11 0.8
12 0.78
13 0.7
14 0.63
15 0.54
16 0.44
17 0.4
18 0.31
19 0.27
20 0.19
21 0.21
22 0.18
23 0.18
24 0.17
25 0.15
26 0.13
27 0.09
28 0.09
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.06
35 0.08
36 0.11
37 0.17
38 0.25
39 0.34
40 0.39
41 0.48
42 0.54
43 0.64
44 0.69
45 0.65
46 0.59
47 0.55
48 0.53
49 0.43
50 0.35
51 0.24
52 0.18
53 0.15
54 0.14
55 0.09
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.07
62 0.07
63 0.08
64 0.09
65 0.1
66 0.09
67 0.1
68 0.11
69 0.1
70 0.1
71 0.1
72 0.11
73 0.12