Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150VE12

Protein Details
Accession A0A150VE12    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
126-146GEPAPKRKRGRPTKAQAQAKAHydrophilic
NLS Segment(s)
PositionSequence
126-140GEPAPKRKRGRPTKA
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MADPRPWTDYEKNELLAEIIKTAAPHPSVLFNVIAHHNIPLRWEDTPLPRGRSLNHCRFIFEELRRTQPPAVTAGPSGPYGPQTPLSAPPGGFKRPFSVEAPYQGGREIRPKPFPPSGMSGHIPSGEPAPKRKRGRPTKAQAQAKAAAAEAAGQAPPPASARPPQVSSPQSAPPAMGDTPGPTEEAKSSHPPVTKMPISAVLTPSAPKTASSSGSSSGKRRRTRSTRSEPEGYPMGGGVGGGVVGIPQEYESPYGLEAEPLMDTSPARSAVMRHRELHGPEQTDPFHLPSIESRTEPPLPPPGNPVAPGGSRRPGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.29
4 0.23
5 0.16
6 0.13
7 0.12
8 0.12
9 0.13
10 0.16
11 0.14
12 0.15
13 0.16
14 0.18
15 0.19
16 0.2
17 0.21
18 0.16
19 0.19
20 0.2
21 0.2
22 0.17
23 0.19
24 0.19
25 0.18
26 0.2
27 0.19
28 0.19
29 0.18
30 0.21
31 0.23
32 0.28
33 0.36
34 0.39
35 0.41
36 0.42
37 0.43
38 0.44
39 0.5
40 0.53
41 0.55
42 0.58
43 0.53
44 0.52
45 0.52
46 0.53
47 0.51
48 0.45
49 0.44
50 0.39
51 0.46
52 0.45
53 0.47
54 0.43
55 0.37
56 0.34
57 0.3
58 0.28
59 0.23
60 0.22
61 0.21
62 0.2
63 0.18
64 0.17
65 0.13
66 0.13
67 0.13
68 0.14
69 0.14
70 0.15
71 0.16
72 0.19
73 0.22
74 0.22
75 0.2
76 0.23
77 0.25
78 0.28
79 0.28
80 0.25
81 0.26
82 0.28
83 0.3
84 0.28
85 0.29
86 0.27
87 0.29
88 0.33
89 0.3
90 0.26
91 0.25
92 0.24
93 0.2
94 0.25
95 0.27
96 0.27
97 0.33
98 0.35
99 0.4
100 0.42
101 0.43
102 0.39
103 0.38
104 0.37
105 0.34
106 0.34
107 0.28
108 0.25
109 0.24
110 0.21
111 0.16
112 0.16
113 0.16
114 0.16
115 0.23
116 0.29
117 0.38
118 0.44
119 0.5
120 0.57
121 0.64
122 0.73
123 0.75
124 0.78
125 0.79
126 0.82
127 0.81
128 0.74
129 0.67
130 0.6
131 0.5
132 0.41
133 0.31
134 0.21
135 0.15
136 0.12
137 0.08
138 0.06
139 0.05
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.05
146 0.06
147 0.09
148 0.13
149 0.15
150 0.17
151 0.19
152 0.24
153 0.25
154 0.26
155 0.27
156 0.26
157 0.25
158 0.23
159 0.22
160 0.16
161 0.17
162 0.14
163 0.12
164 0.09
165 0.08
166 0.09
167 0.1
168 0.1
169 0.08
170 0.08
171 0.09
172 0.11
173 0.13
174 0.16
175 0.18
176 0.22
177 0.24
178 0.24
179 0.26
180 0.31
181 0.29
182 0.26
183 0.24
184 0.25
185 0.26
186 0.26
187 0.24
188 0.18
189 0.17
190 0.17
191 0.17
192 0.13
193 0.11
194 0.09
195 0.12
196 0.14
197 0.16
198 0.17
199 0.18
200 0.2
201 0.25
202 0.28
203 0.31
204 0.37
205 0.44
206 0.49
207 0.53
208 0.6
209 0.64
210 0.72
211 0.76
212 0.79
213 0.79
214 0.79
215 0.8
216 0.69
217 0.65
218 0.57
219 0.47
220 0.35
221 0.25
222 0.19
223 0.12
224 0.11
225 0.06
226 0.03
227 0.03
228 0.02
229 0.02
230 0.02
231 0.02
232 0.02
233 0.02
234 0.03
235 0.04
236 0.05
237 0.07
238 0.08
239 0.08
240 0.09
241 0.11
242 0.1
243 0.1
244 0.09
245 0.09
246 0.08
247 0.08
248 0.08
249 0.07
250 0.07
251 0.08
252 0.11
253 0.11
254 0.11
255 0.12
256 0.15
257 0.24
258 0.34
259 0.37
260 0.37
261 0.39
262 0.45
263 0.48
264 0.52
265 0.49
266 0.44
267 0.42
268 0.45
269 0.42
270 0.39
271 0.37
272 0.32
273 0.27
274 0.23
275 0.22
276 0.22
277 0.29
278 0.28
279 0.28
280 0.28
281 0.32
282 0.37
283 0.37
284 0.36
285 0.39
286 0.38
287 0.37
288 0.41
289 0.41
290 0.39
291 0.39
292 0.37
293 0.32
294 0.33
295 0.36
296 0.36