Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UMK6

Protein Details
Accession A0A150UMK6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLTTKTRRRVQRNRHRKMQQQHIPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MLTTKTRRRVQRNRHRKMQQQHIPNLEIAEEIEEGIYKLASSLKIHYITATLRKSRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.88
4 0.87
5 0.87
6 0.83
7 0.8
8 0.78
9 0.71
10 0.64
11 0.54
12 0.45
13 0.34
14 0.25
15 0.16
16 0.11
17 0.07
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.03
25 0.04
26 0.05
27 0.07
28 0.09
29 0.11
30 0.16
31 0.18
32 0.18
33 0.18
34 0.19
35 0.22
36 0.29
37 0.33