Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UT92

Protein Details
Accession A0A150UT92    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
209-229VNFYWPKLRRMRCPEVKIFNTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto 10, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022198  DUF3723  
Pfam View protein in Pfam  
PF12520  DUF3723  
Amino Acid Sequences MNLELKFRGLFRIPLHNLDFNLALKIGHREKNSNIRQQLLRKFNEKGCKREIECNHIIALVDECKINRLQNYTRPWTDVDCIGKVNCLNGLHRAWAAEDHLKGNDRWWTVELFSGSAAALRDPAYLKLEGLDVNCADIVEEWSGESEYSPNDVIVKIMSYQSLGEQQRADMWKLRLNDHQEKEWKCFLKSDFGRILEAMWRWPGMFDGVNFYWPKLRRMRCPEVKIFNTVRKNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.44
4 0.42
5 0.39
6 0.38
7 0.28
8 0.26
9 0.2
10 0.15
11 0.14
12 0.2
13 0.24
14 0.28
15 0.31
16 0.34
17 0.41
18 0.51
19 0.58
20 0.6
21 0.57
22 0.57
23 0.6
24 0.65
25 0.68
26 0.65
27 0.62
28 0.57
29 0.6
30 0.6
31 0.64
32 0.61
33 0.57
34 0.55
35 0.59
36 0.57
37 0.62
38 0.6
39 0.59
40 0.56
41 0.51
42 0.44
43 0.36
44 0.33
45 0.24
46 0.21
47 0.14
48 0.11
49 0.11
50 0.1
51 0.11
52 0.13
53 0.14
54 0.14
55 0.19
56 0.23
57 0.3
58 0.38
59 0.42
60 0.42
61 0.42
62 0.41
63 0.37
64 0.35
65 0.31
66 0.27
67 0.21
68 0.21
69 0.2
70 0.2
71 0.18
72 0.16
73 0.14
74 0.12
75 0.12
76 0.15
77 0.16
78 0.15
79 0.15
80 0.15
81 0.12
82 0.12
83 0.13
84 0.13
85 0.13
86 0.13
87 0.14
88 0.15
89 0.14
90 0.16
91 0.18
92 0.15
93 0.15
94 0.15
95 0.15
96 0.14
97 0.16
98 0.14
99 0.1
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.08
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.09
117 0.09
118 0.09
119 0.07
120 0.07
121 0.07
122 0.07
123 0.06
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.15
150 0.15
151 0.17
152 0.16
153 0.16
154 0.21
155 0.23
156 0.24
157 0.22
158 0.24
159 0.27
160 0.28
161 0.32
162 0.33
163 0.4
164 0.47
165 0.45
166 0.5
167 0.53
168 0.54
169 0.56
170 0.57
171 0.52
172 0.43
173 0.45
174 0.4
175 0.43
176 0.42
177 0.44
178 0.42
179 0.4
180 0.41
181 0.36
182 0.35
183 0.29
184 0.27
185 0.22
186 0.18
187 0.17
188 0.15
189 0.15
190 0.15
191 0.13
192 0.14
193 0.13
194 0.18
195 0.18
196 0.23
197 0.23
198 0.23
199 0.28
200 0.28
201 0.35
202 0.37
203 0.44
204 0.5
205 0.59
206 0.69
207 0.72
208 0.78
209 0.81
210 0.82
211 0.78
212 0.76
213 0.73
214 0.71