Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V221

Protein Details
Accession A0A150V221   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
301-320SPGQCRDKARWRRTSPILRWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 6, cyto_nucl 5, nucl 4.5, cyto 4.5, extr 4, mito 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR013094  AB_hydrolase_3  
Gene Ontology GO:0016020  C:membrane  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF07859  Abhydrolase_3  
Amino Acid Sequences MILDRIAWLDCFAFLLFLTPQLIIHVGFIRTTICGLQALPHLLCILPYQLIRERYFTHQDRRSPFVQQATLFQDIVIRCVRYAFAFIPAEIGKIFFSKWVALPFFRFRMLRNGWLSCPIYWREIDREGLKGIYMAYDETQRPDIVVYYCHGGGFSMGSSYFYIEFLLGWVTLLKDAGFDNPALFALEYTLVPEATYPTQLQQTLAGYKYVLSIADEHPERVCVSGDSAGATLILSLILLLSDYAKMGDKLPGLAIPISPWSIIISKKNQNTPSDYLNAESLRLYGSQYIGQKASDSDSLVSPGQCRDKARWRRTSPILRWLFIYGAEEVFAPDARDLISLLRDADLEVQTHEEKGWIHAWPVVKLFICNKRQDRLHGLSIMVEYMKDKMLVKEAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.1
4 0.11
5 0.12
6 0.11
7 0.11
8 0.12
9 0.13
10 0.1
11 0.12
12 0.14
13 0.13
14 0.13
15 0.14
16 0.13
17 0.13
18 0.14
19 0.12
20 0.09
21 0.1
22 0.1
23 0.13
24 0.16
25 0.2
26 0.18
27 0.18
28 0.18
29 0.17
30 0.17
31 0.15
32 0.13
33 0.12
34 0.12
35 0.16
36 0.22
37 0.28
38 0.29
39 0.31
40 0.33
41 0.37
42 0.46
43 0.48
44 0.52
45 0.54
46 0.6
47 0.61
48 0.63
49 0.59
50 0.54
51 0.52
52 0.49
53 0.46
54 0.39
55 0.4
56 0.39
57 0.39
58 0.34
59 0.29
60 0.27
61 0.23
62 0.25
63 0.22
64 0.18
65 0.15
66 0.16
67 0.17
68 0.13
69 0.17
70 0.14
71 0.18
72 0.18
73 0.18
74 0.2
75 0.2
76 0.2
77 0.16
78 0.16
79 0.1
80 0.1
81 0.1
82 0.08
83 0.1
84 0.11
85 0.12
86 0.17
87 0.19
88 0.19
89 0.24
90 0.27
91 0.28
92 0.3
93 0.29
94 0.25
95 0.33
96 0.35
97 0.37
98 0.38
99 0.38
100 0.36
101 0.41
102 0.41
103 0.32
104 0.33
105 0.27
106 0.25
107 0.23
108 0.25
109 0.23
110 0.24
111 0.27
112 0.24
113 0.24
114 0.22
115 0.22
116 0.19
117 0.15
118 0.12
119 0.09
120 0.08
121 0.07
122 0.07
123 0.1
124 0.11
125 0.12
126 0.14
127 0.13
128 0.13
129 0.12
130 0.13
131 0.1
132 0.11
133 0.1
134 0.11
135 0.11
136 0.11
137 0.1
138 0.08
139 0.08
140 0.07
141 0.06
142 0.05
143 0.04
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.05
153 0.06
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.05
160 0.04
161 0.04
162 0.05
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.06
177 0.05
178 0.05
179 0.05
180 0.06
181 0.06
182 0.08
183 0.07
184 0.08
185 0.1
186 0.1
187 0.1
188 0.1
189 0.11
190 0.12
191 0.12
192 0.11
193 0.09
194 0.09
195 0.09
196 0.08
197 0.07
198 0.06
199 0.07
200 0.08
201 0.12
202 0.13
203 0.13
204 0.12
205 0.13
206 0.13
207 0.11
208 0.11
209 0.07
210 0.08
211 0.09
212 0.09
213 0.09
214 0.08
215 0.07
216 0.07
217 0.06
218 0.05
219 0.03
220 0.03
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.03
228 0.03
229 0.03
230 0.04
231 0.05
232 0.06
233 0.07
234 0.09
235 0.09
236 0.1
237 0.1
238 0.1
239 0.1
240 0.1
241 0.09
242 0.07
243 0.08
244 0.08
245 0.08
246 0.07
247 0.08
248 0.1
249 0.12
250 0.17
251 0.23
252 0.29
253 0.35
254 0.41
255 0.45
256 0.46
257 0.5
258 0.48
259 0.45
260 0.41
261 0.36
262 0.3
263 0.29
264 0.26
265 0.2
266 0.17
267 0.13
268 0.11
269 0.11
270 0.1
271 0.09
272 0.1
273 0.13
274 0.15
275 0.18
276 0.17
277 0.17
278 0.17
279 0.16
280 0.18
281 0.15
282 0.14
283 0.13
284 0.13
285 0.15
286 0.16
287 0.16
288 0.14
289 0.18
290 0.22
291 0.24
292 0.26
293 0.31
294 0.4
295 0.51
296 0.59
297 0.66
298 0.66
299 0.71
300 0.78
301 0.82
302 0.77
303 0.77
304 0.72
305 0.62
306 0.58
307 0.51
308 0.41
309 0.31
310 0.27
311 0.18
312 0.13
313 0.13
314 0.11
315 0.1
316 0.1
317 0.1
318 0.09
319 0.07
320 0.08
321 0.08
322 0.08
323 0.08
324 0.09
325 0.1
326 0.1
327 0.1
328 0.11
329 0.1
330 0.1
331 0.14
332 0.14
333 0.13
334 0.13
335 0.16
336 0.16
337 0.17
338 0.16
339 0.14
340 0.14
341 0.16
342 0.18
343 0.16
344 0.16
345 0.19
346 0.22
347 0.22
348 0.24
349 0.24
350 0.22
351 0.24
352 0.31
353 0.37
354 0.42
355 0.49
356 0.53
357 0.57
358 0.61
359 0.65
360 0.66
361 0.64
362 0.63
363 0.56
364 0.51
365 0.45
366 0.41
367 0.35
368 0.26
369 0.19
370 0.14
371 0.13
372 0.14
373 0.14
374 0.15
375 0.16