Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V211

Protein Details
Accession A0A150V211   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-110QCIWWETRLPRQRRNTTQCFLKQRAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 4, extr 3, vacu 2
Family & Domain DBs
Amino Acid Sequences MCVCVCVYVFMCLRACARAVRAFVLVCMVCSVCVRESARVCTCVWFRNCFDAGSDHYDAVAQRRRGHSYSTPKDAASLHLRGRALQCIWWETRLPRQRRNTTQCFLKQRAIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.2
5 0.22
6 0.22
7 0.23
8 0.23
9 0.22
10 0.21
11 0.23
12 0.18
13 0.14
14 0.13
15 0.11
16 0.1
17 0.1
18 0.12
19 0.08
20 0.13
21 0.14
22 0.18
23 0.21
24 0.26
25 0.28
26 0.28
27 0.28
28 0.27
29 0.28
30 0.3
31 0.3
32 0.28
33 0.27
34 0.3
35 0.31
36 0.27
37 0.26
38 0.21
39 0.21
40 0.22
41 0.21
42 0.16
43 0.15
44 0.16
45 0.15
46 0.17
47 0.21
48 0.18
49 0.21
50 0.24
51 0.28
52 0.29
53 0.33
54 0.37
55 0.42
56 0.45
57 0.48
58 0.46
59 0.42
60 0.43
61 0.39
62 0.35
63 0.29
64 0.28
65 0.23
66 0.26
67 0.26
68 0.27
69 0.28
70 0.28
71 0.24
72 0.22
73 0.22
74 0.22
75 0.24
76 0.24
77 0.25
78 0.24
79 0.34
80 0.41
81 0.46
82 0.51
83 0.6
84 0.68
85 0.76
86 0.83
87 0.81
88 0.79
89 0.82
90 0.82
91 0.8
92 0.75