Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UTG9

Protein Details
Accession A0A150UTG9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAAGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 14.5, cyto_nucl 9.5, mito 8, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGKKQKKKWSKGKVKDKANHAVVLDKNTAEKLQKDVQSYRLITVAVLVDRLKINGSLARKALSDLEAKGQIKKVVSHSAGNIYTRAVGGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.92
7 0.88
8 0.85
9 0.83
10 0.75
11 0.66
12 0.56
13 0.52
14 0.43
15 0.4
16 0.33
17 0.24
18 0.21
19 0.19
20 0.2
21 0.16
22 0.15
23 0.16
24 0.21
25 0.24
26 0.27
27 0.28
28 0.3
29 0.33
30 0.33
31 0.29
32 0.23
33 0.2
34 0.16
35 0.15
36 0.12
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.08
46 0.1
47 0.13
48 0.14
49 0.15
50 0.16
51 0.16
52 0.16
53 0.17
54 0.15
55 0.15
56 0.13
57 0.17
58 0.21
59 0.22
60 0.24
61 0.25
62 0.26
63 0.25
64 0.27
65 0.28
66 0.31
67 0.33
68 0.33
69 0.32
70 0.36
71 0.37
72 0.35
73 0.31
74 0.24
75 0.22
76 0.19