Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150UU97

Protein Details
Accession A0A150UU97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-72ASQSKRSKEQHFERVRRRCASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 6, cyto 4
Family & Domain DBs
Amino Acid Sequences PLNKLNAITIACGMGIAGMSKRSRRWTNWAGLTFGQLFLPKPTRVYFASDSASQSKRSKEQHFERVRRRCASPNSNDGELAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.09
6 0.11
7 0.14
8 0.18
9 0.26
10 0.31
11 0.34
12 0.43
13 0.46
14 0.52
15 0.57
16 0.55
17 0.5
18 0.44
19 0.42
20 0.34
21 0.27
22 0.19
23 0.12
24 0.11
25 0.11
26 0.14
27 0.12
28 0.14
29 0.14
30 0.17
31 0.17
32 0.22
33 0.22
34 0.21
35 0.24
36 0.23
37 0.25
38 0.26
39 0.27
40 0.26
41 0.26
42 0.27
43 0.32
44 0.38
45 0.43
46 0.48
47 0.55
48 0.62
49 0.7
50 0.76
51 0.79
52 0.82
53 0.82
54 0.77
55 0.74
56 0.72
57 0.72
58 0.72
59 0.69
60 0.68
61 0.66
62 0.63