Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UPT0

Protein Details
Accession A0A150UPT0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLTAKTRRRVQRNRHRKMQQQHIPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MLTAKTRRRVQRNRHRKMQQQHIPNLEIAEEIEEGIYKLAHSLKIHYITAALRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.87
4 0.87
5 0.86
6 0.83
7 0.8
8 0.77
9 0.71
10 0.63
11 0.54
12 0.44
13 0.33
14 0.25
15 0.16
16 0.11
17 0.07
18 0.05
19 0.05
20 0.04
21 0.05
22 0.05
23 0.05
24 0.03
25 0.05
26 0.07
27 0.11
28 0.11
29 0.15
30 0.21
31 0.25
32 0.25
33 0.24
34 0.24