Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150VA03

Protein Details
Accession A0A150VA03   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-130ESGSCLQRRWRARHDNLARRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 6, extr 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MPSTGTYTYANTPEHSPVLSPVLSPVLSPVQPSPHPHIPPPIHPSNYPSAHPPIIYPPIHRPSHRHICIDVCASAIPLGDELIQQEVQASSWAEGERARRWPTVCPKPCESGSCLQRRWRARHDNLARRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.21
4 0.18
5 0.21
6 0.19
7 0.16
8 0.14
9 0.15
10 0.15
11 0.14
12 0.14
13 0.14
14 0.14
15 0.15
16 0.15
17 0.18
18 0.21
19 0.25
20 0.31
21 0.35
22 0.37
23 0.37
24 0.45
25 0.43
26 0.46
27 0.49
28 0.47
29 0.42
30 0.41
31 0.43
32 0.41
33 0.4
34 0.35
35 0.31
36 0.29
37 0.27
38 0.26
39 0.23
40 0.2
41 0.23
42 0.23
43 0.22
44 0.25
45 0.32
46 0.34
47 0.34
48 0.35
49 0.37
50 0.47
51 0.48
52 0.43
53 0.37
54 0.36
55 0.37
56 0.34
57 0.26
58 0.16
59 0.12
60 0.11
61 0.1
62 0.08
63 0.06
64 0.04
65 0.05
66 0.04
67 0.04
68 0.05
69 0.06
70 0.06
71 0.06
72 0.07
73 0.06
74 0.06
75 0.08
76 0.08
77 0.06
78 0.08
79 0.08
80 0.08
81 0.11
82 0.14
83 0.17
84 0.23
85 0.26
86 0.28
87 0.29
88 0.38
89 0.46
90 0.53
91 0.58
92 0.57
93 0.59
94 0.61
95 0.63
96 0.58
97 0.52
98 0.51
99 0.52
100 0.54
101 0.55
102 0.57
103 0.62
104 0.67
105 0.71
106 0.72
107 0.73
108 0.72
109 0.78
110 0.82