Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V7C6

Protein Details
Accession A0A150V7C6   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-75SNLHRLSRARKVRRTNRCGRVHydrophilic
NLS Segment(s)
PositionSequence
63-69ARKVRRT
81-82HR
85-113PAAAAAAAAAGANRGARKAQARPRRPPPA
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MITLLENRDEAPAKARIPETGWRLWPFPRDHCCCSVGRMLVPGRQRECSKPHFISNLHRLSRARKVRRTNRCGRVLAPRLHRLSPAAAAAAAAAGANRGARKAQARPRRPPPATTFHRTSPRPSISPAPSSRHSPGIPPIRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.25
4 0.27
5 0.33
6 0.34
7 0.34
8 0.39
9 0.37
10 0.38
11 0.4
12 0.43
13 0.4
14 0.43
15 0.47
16 0.49
17 0.5
18 0.51
19 0.51
20 0.45
21 0.44
22 0.41
23 0.33
24 0.27
25 0.28
26 0.26
27 0.28
28 0.32
29 0.34
30 0.31
31 0.34
32 0.36
33 0.36
34 0.4
35 0.42
36 0.45
37 0.42
38 0.43
39 0.44
40 0.43
41 0.47
42 0.49
43 0.51
44 0.43
45 0.44
46 0.41
47 0.41
48 0.48
49 0.5
50 0.5
51 0.5
52 0.6
53 0.67
54 0.76
55 0.8
56 0.81
57 0.79
58 0.77
59 0.71
60 0.63
61 0.62
62 0.58
63 0.56
64 0.51
65 0.49
66 0.45
67 0.44
68 0.43
69 0.34
70 0.29
71 0.24
72 0.19
73 0.12
74 0.09
75 0.08
76 0.08
77 0.06
78 0.05
79 0.03
80 0.03
81 0.02
82 0.03
83 0.04
84 0.04
85 0.05
86 0.06
87 0.09
88 0.13
89 0.22
90 0.32
91 0.41
92 0.5
93 0.59
94 0.68
95 0.76
96 0.74
97 0.73
98 0.7
99 0.69
100 0.68
101 0.66
102 0.62
103 0.58
104 0.64
105 0.6
106 0.59
107 0.59
108 0.58
109 0.52
110 0.52
111 0.53
112 0.5
113 0.56
114 0.55
115 0.52
116 0.49
117 0.53
118 0.52
119 0.5
120 0.46
121 0.41
122 0.46
123 0.49