Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UPL0

Protein Details
Accession A0A150UPL0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-88KTLNKRLQRVREKRDRLVKERBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.833, nucl 14.5, cyto 12, cyto_mito 6.999
Family & Domain DBs
Amino Acid Sequences MNYALHELSIGLNYSLVVWLDTPYSIIHLPLVGGPLGHKCSISNNITTTLLVPINEKSLGECEQLVAKTLNKRLQRVREKRDRLVKERELQRIEDECALLERKTASDVGND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.06
6 0.07
7 0.07
8 0.07
9 0.08
10 0.07
11 0.09
12 0.09
13 0.09
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.06
20 0.06
21 0.06
22 0.09
23 0.11
24 0.11
25 0.1
26 0.1
27 0.13
28 0.2
29 0.21
30 0.2
31 0.19
32 0.21
33 0.21
34 0.21
35 0.18
36 0.14
37 0.12
38 0.11
39 0.1
40 0.09
41 0.1
42 0.1
43 0.09
44 0.07
45 0.09
46 0.1
47 0.1
48 0.1
49 0.09
50 0.1
51 0.11
52 0.12
53 0.11
54 0.12
55 0.16
56 0.21
57 0.27
58 0.29
59 0.34
60 0.4
61 0.5
62 0.58
63 0.64
64 0.68
65 0.73
66 0.76
67 0.8
68 0.83
69 0.81
70 0.76
71 0.76
72 0.74
73 0.72
74 0.73
75 0.73
76 0.66
77 0.59
78 0.58
79 0.52
80 0.47
81 0.39
82 0.32
83 0.24
84 0.24
85 0.24
86 0.18
87 0.17
88 0.15
89 0.14
90 0.16
91 0.17