Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V9L1

Protein Details
Accession A0A150V9L1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-31RRTSKSPKCYSLPKHKRVNFQKILPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.666, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MTMLVSRRTSKSPKCYSLPKHKRVNFQKILPFWVHRTTLHVCCPAAQMYATEIQIAYEFTHLRTKVSLLRGSCPRENNLSCKTKGRCCERLQCNPPITWCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.75
4 0.78
5 0.8
6 0.79
7 0.8
8 0.79
9 0.84
10 0.84
11 0.85
12 0.8
13 0.76
14 0.75
15 0.66
16 0.64
17 0.56
18 0.48
19 0.41
20 0.38
21 0.33
22 0.25
23 0.29
24 0.3
25 0.3
26 0.31
27 0.3
28 0.26
29 0.25
30 0.26
31 0.21
32 0.17
33 0.13
34 0.1
35 0.09
36 0.11
37 0.1
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.06
44 0.06
45 0.06
46 0.08
47 0.13
48 0.13
49 0.14
50 0.14
51 0.15
52 0.19
53 0.23
54 0.26
55 0.22
56 0.28
57 0.34
58 0.39
59 0.42
60 0.4
61 0.38
62 0.43
63 0.44
64 0.45
65 0.47
66 0.47
67 0.45
68 0.51
69 0.54
70 0.53
71 0.59
72 0.61
73 0.61
74 0.62
75 0.71
76 0.71
77 0.77
78 0.76
79 0.76
80 0.72
81 0.66