Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150UY64

Protein Details
Accession A0A150UY64    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLTAKTRRRVQRNRHRKMQQQHIPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MLTAKTRRRVQRNRHRKMQQQHIPNLEIAEEIEEGIFKLASSLKIHYITATLRKSRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.87
5 0.87
6 0.83
7 0.8
8 0.78
9 0.71
10 0.64
11 0.54
12 0.45
13 0.34
14 0.25
15 0.16
16 0.11
17 0.07
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.03
25 0.04
26 0.06
27 0.08
28 0.1
29 0.12
30 0.16
31 0.18
32 0.18
33 0.17
34 0.18
35 0.2
36 0.27
37 0.32