Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V2G9

Protein Details
Accession A0A150V2G9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-42LTPAELKKRAKAEKQARRAAAKHydrophilic
NLS Segment(s)
PositionSequence
27-40KKRAKAEKQARRAA
Subcellular Location(s) cyto 15.5, cyto_nucl 12.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000649  IF-2B-related  
IPR042529  IF_2B-like_C  
IPR037171  NagB/RpiA_transferase-like  
Gene Ontology GO:1901566  P:organonitrogen compound biosynthetic process  
Pfam View protein in Pfam  
PF01008  IF-2B  
Amino Acid Sequences MSEPQKPQEPAKLSDGDEIKLTPAELKKRAKAEKQARRAAAKEQQGGATAPPMTNGVSEKANPAQEGKARGVHQKAPVQAKQGKQGAQQDGKQEVHQTPETKSLAVRRRGSQSGGGISSKDVAKRDNKQVELFSHLYAQPRRYQLENAHKDVHPAVQQLGLQISRYQICGSSARCVGMLLAFKQVIQAYDTPSGTSLPRHLTHHLSPQIEWLKACRPLGESMGNAIRWLKKLIVEIDPSMEQQAAKDYLCAEIDRFLRERIVVTDQAIAAAAAAQIRPGAVVLTYAKSAIVEQTLRRAHSAGTSFRVVCLDSRPLFEGRALARSLVRAGIEVEYLPYAGLAYAVQHASLVLLGAHSMLSNGRLMSRIGTAGLAMQAHLHSIPVIVCCESVKFSGKVALDSIVLNEVAPAEELLPMPPQHLSSPADGDGAMKDREKADGDDDGTGKVKKLGDWKDITGLQILNLMYDVTPAEYIRMVICEYGNVPPSSVPVVHRLANEGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.38
4 0.34
5 0.3
6 0.26
7 0.21
8 0.2
9 0.19
10 0.23
11 0.3
12 0.37
13 0.44
14 0.5
15 0.58
16 0.67
17 0.69
18 0.74
19 0.77
20 0.79
21 0.82
22 0.85
23 0.82
24 0.79
25 0.73
26 0.71
27 0.68
28 0.66
29 0.61
30 0.54
31 0.48
32 0.44
33 0.42
34 0.34
35 0.29
36 0.22
37 0.16
38 0.15
39 0.15
40 0.13
41 0.14
42 0.15
43 0.14
44 0.15
45 0.16
46 0.2
47 0.23
48 0.25
49 0.24
50 0.24
51 0.27
52 0.29
53 0.32
54 0.31
55 0.33
56 0.33
57 0.4
58 0.42
59 0.43
60 0.46
61 0.47
62 0.51
63 0.53
64 0.53
65 0.54
66 0.55
67 0.53
68 0.55
69 0.55
70 0.51
71 0.49
72 0.54
73 0.55
74 0.55
75 0.55
76 0.51
77 0.51
78 0.49
79 0.44
80 0.41
81 0.34
82 0.34
83 0.35
84 0.32
85 0.28
86 0.35
87 0.35
88 0.3
89 0.31
90 0.35
91 0.39
92 0.45
93 0.48
94 0.45
95 0.5
96 0.52
97 0.53
98 0.48
99 0.43
100 0.39
101 0.36
102 0.32
103 0.26
104 0.24
105 0.24
106 0.21
107 0.2
108 0.17
109 0.2
110 0.27
111 0.34
112 0.44
113 0.48
114 0.49
115 0.49
116 0.51
117 0.48
118 0.48
119 0.42
120 0.33
121 0.29
122 0.27
123 0.31
124 0.31
125 0.31
126 0.3
127 0.33
128 0.35
129 0.33
130 0.36
131 0.39
132 0.47
133 0.51
134 0.49
135 0.5
136 0.47
137 0.47
138 0.44
139 0.38
140 0.29
141 0.24
142 0.2
143 0.17
144 0.17
145 0.16
146 0.17
147 0.14
148 0.12
149 0.12
150 0.13
151 0.12
152 0.12
153 0.12
154 0.1
155 0.12
156 0.15
157 0.16
158 0.18
159 0.18
160 0.18
161 0.17
162 0.17
163 0.15
164 0.13
165 0.14
166 0.11
167 0.12
168 0.12
169 0.12
170 0.13
171 0.13
172 0.11
173 0.11
174 0.11
175 0.12
176 0.16
177 0.16
178 0.14
179 0.14
180 0.15
181 0.14
182 0.14
183 0.13
184 0.14
185 0.16
186 0.19
187 0.21
188 0.25
189 0.27
190 0.34
191 0.37
192 0.33
193 0.31
194 0.35
195 0.36
196 0.32
197 0.29
198 0.23
199 0.23
200 0.25
201 0.25
202 0.19
203 0.18
204 0.19
205 0.22
206 0.21
207 0.17
208 0.16
209 0.18
210 0.17
211 0.15
212 0.15
213 0.14
214 0.13
215 0.14
216 0.12
217 0.12
218 0.14
219 0.17
220 0.18
221 0.18
222 0.17
223 0.18
224 0.18
225 0.16
226 0.14
227 0.12
228 0.08
229 0.07
230 0.09
231 0.08
232 0.08
233 0.08
234 0.08
235 0.09
236 0.09
237 0.09
238 0.07
239 0.1
240 0.11
241 0.13
242 0.14
243 0.13
244 0.13
245 0.13
246 0.14
247 0.12
248 0.14
249 0.13
250 0.13
251 0.14
252 0.13
253 0.13
254 0.12
255 0.09
256 0.06
257 0.05
258 0.04
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.04
269 0.05
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.07
276 0.06
277 0.07
278 0.08
279 0.08
280 0.16
281 0.18
282 0.18
283 0.19
284 0.19
285 0.17
286 0.2
287 0.23
288 0.18
289 0.19
290 0.21
291 0.2
292 0.2
293 0.2
294 0.17
295 0.14
296 0.15
297 0.17
298 0.16
299 0.18
300 0.2
301 0.2
302 0.2
303 0.19
304 0.2
305 0.15
306 0.18
307 0.16
308 0.15
309 0.15
310 0.15
311 0.15
312 0.12
313 0.11
314 0.08
315 0.09
316 0.09
317 0.09
318 0.08
319 0.08
320 0.07
321 0.07
322 0.06
323 0.05
324 0.04
325 0.04
326 0.04
327 0.03
328 0.04
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.06
335 0.06
336 0.05
337 0.03
338 0.03
339 0.03
340 0.03
341 0.04
342 0.03
343 0.04
344 0.04
345 0.05
346 0.06
347 0.06
348 0.07
349 0.08
350 0.08
351 0.09
352 0.1
353 0.1
354 0.09
355 0.09
356 0.08
357 0.08
358 0.09
359 0.07
360 0.06
361 0.07
362 0.06
363 0.07
364 0.07
365 0.06
366 0.05
367 0.06
368 0.07
369 0.07
370 0.09
371 0.08
372 0.09
373 0.09
374 0.1
375 0.11
376 0.13
377 0.16
378 0.15
379 0.16
380 0.21
381 0.21
382 0.22
383 0.21
384 0.2
385 0.16
386 0.16
387 0.16
388 0.11
389 0.1
390 0.09
391 0.08
392 0.07
393 0.06
394 0.07
395 0.06
396 0.05
397 0.06
398 0.07
399 0.08
400 0.1
401 0.1
402 0.11
403 0.12
404 0.13
405 0.13
406 0.17
407 0.18
408 0.17
409 0.2
410 0.2
411 0.2
412 0.18
413 0.18
414 0.16
415 0.17
416 0.17
417 0.15
418 0.16
419 0.16
420 0.19
421 0.21
422 0.21
423 0.21
424 0.23
425 0.24
426 0.26
427 0.26
428 0.25
429 0.25
430 0.24
431 0.21
432 0.21
433 0.21
434 0.21
435 0.29
436 0.35
437 0.4
438 0.44
439 0.45
440 0.47
441 0.47
442 0.45
443 0.39
444 0.32
445 0.24
446 0.23
447 0.21
448 0.15
449 0.14
450 0.13
451 0.1
452 0.1
453 0.1
454 0.07
455 0.09
456 0.08
457 0.1
458 0.1
459 0.1
460 0.11
461 0.12
462 0.11
463 0.12
464 0.12
465 0.12
466 0.14
467 0.17
468 0.22
469 0.2
470 0.2
471 0.19
472 0.21
473 0.23
474 0.23
475 0.21
476 0.22
477 0.26
478 0.29
479 0.29