Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150VB68

Protein Details
Accession A0A150VB68   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-36TGSSRLVPSKKAKRQKQCRRKSTLMTKACEHydrophilic
NLS Segment(s)
PositionSequence
17-20KAKR
Subcellular Location(s) mito_nucl 12.333, nucl 12, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAPAHHTGSSRLVPSKKAKRQKQCRRKSTLMTKACEFSKMCDADVCLGIRLRETGQVYFFSADASGFWAFLSSQLNSYYPTPKLVTDRDLEVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.58
4 0.65
5 0.72
6 0.76
7 0.86
8 0.91
9 0.91
10 0.92
11 0.91
12 0.9
13 0.88
14 0.86
15 0.86
16 0.84
17 0.8
18 0.73
19 0.65
20 0.59
21 0.52
22 0.46
23 0.36
24 0.28
25 0.28
26 0.25
27 0.23
28 0.2
29 0.2
30 0.18
31 0.19
32 0.16
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.08
39 0.11
40 0.12
41 0.12
42 0.13
43 0.14
44 0.15
45 0.14
46 0.14
47 0.1
48 0.09
49 0.08
50 0.06
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.09
58 0.11
59 0.09
60 0.11
61 0.12
62 0.13
63 0.15
64 0.18
65 0.21
66 0.19
67 0.22
68 0.22
69 0.24
70 0.29
71 0.3
72 0.32
73 0.31