Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JDS5

Protein Details
Accession G3JDS5    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-75ASVKRTVQKKYTRRPVHRIRGPEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
KEGG cmt:CCM_04123  -  
Amino Acid Sequences MAKLILLHVSANDATYLPVKPGPVAEYEPQHVMAPIHCPRQRCHELVPCETSASVKRTVQKKYTRRPVHRIRGPEYTVRARILTPYLIPQRLVRSYQKTAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.11
5 0.12
6 0.12
7 0.12
8 0.13
9 0.13
10 0.14
11 0.17
12 0.19
13 0.2
14 0.22
15 0.23
16 0.22
17 0.21
18 0.19
19 0.15
20 0.13
21 0.17
22 0.18
23 0.26
24 0.27
25 0.28
26 0.29
27 0.38
28 0.42
29 0.38
30 0.41
31 0.4
32 0.43
33 0.44
34 0.46
35 0.36
36 0.32
37 0.29
38 0.25
39 0.19
40 0.17
41 0.17
42 0.16
43 0.22
44 0.27
45 0.32
46 0.39
47 0.46
48 0.53
49 0.61
50 0.7
51 0.74
52 0.76
53 0.81
54 0.84
55 0.85
56 0.82
57 0.78
58 0.72
59 0.7
60 0.65
61 0.6
62 0.56
63 0.51
64 0.47
65 0.42
66 0.38
67 0.3
68 0.29
69 0.27
70 0.23
71 0.18
72 0.23
73 0.28
74 0.29
75 0.3
76 0.31
77 0.35
78 0.37
79 0.41
80 0.41
81 0.42
82 0.47