Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150V7M9

Protein Details
Accession A0A150V7M9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
130-156KDESNLKKAQKKVKRSKPKLAFDNDEGHydrophilic
NLS Segment(s)
PositionSequence
136-148KKAQKKVKRSKPK
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSGKVRSKDLSYDSTLPPFLQRLHAQNSRRGDTDRHERPVARPRREKDPHDDDGPTIVDESGETLSQMEYDKLTQRKTAAPKGGEVDVGIKDEVKDVREKVTDGLATKKRKAGKVIGDEDIGDGQVESAKDESNLKKAQKKVKRSKPKLAFDNDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.33
4 0.3
5 0.27
6 0.23
7 0.24
8 0.26
9 0.28
10 0.35
11 0.42
12 0.43
13 0.48
14 0.53
15 0.5
16 0.49
17 0.46
18 0.41
19 0.41
20 0.49
21 0.49
22 0.48
23 0.48
24 0.47
25 0.51
26 0.58
27 0.6
28 0.59
29 0.61
30 0.59
31 0.66
32 0.72
33 0.7
34 0.69
35 0.67
36 0.62
37 0.57
38 0.54
39 0.43
40 0.38
41 0.34
42 0.24
43 0.17
44 0.12
45 0.08
46 0.07
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.07
58 0.12
59 0.14
60 0.16
61 0.16
62 0.18
63 0.23
64 0.28
65 0.32
66 0.32
67 0.3
68 0.31
69 0.31
70 0.3
71 0.25
72 0.19
73 0.15
74 0.11
75 0.11
76 0.09
77 0.07
78 0.07
79 0.09
80 0.1
81 0.09
82 0.12
83 0.11
84 0.15
85 0.16
86 0.16
87 0.15
88 0.17
89 0.18
90 0.16
91 0.24
92 0.28
93 0.32
94 0.33
95 0.37
96 0.4
97 0.42
98 0.46
99 0.45
100 0.46
101 0.51
102 0.53
103 0.5
104 0.45
105 0.41
106 0.37
107 0.3
108 0.21
109 0.12
110 0.07
111 0.05
112 0.07
113 0.07
114 0.07
115 0.08
116 0.08
117 0.1
118 0.15
119 0.18
120 0.23
121 0.3
122 0.35
123 0.41
124 0.49
125 0.58
126 0.62
127 0.71
128 0.75
129 0.8
130 0.85
131 0.87
132 0.91
133 0.91
134 0.91
135 0.9
136 0.87