Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150USZ5

Protein Details
Accession A0A150USZ5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76ALSRNQDKSPKRKIGKAREQHydrophilic
NLS Segment(s)
PositionSequence
66-74PKRKIGKAR
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MCNYYAYRHLCGHTRMVFAAFCNSAAFLQNPCGRGNIWVTVEMEGNCSTCKMKSDLALSRNQDKSPKRKIGKAREQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.3
4 0.28
5 0.23
6 0.24
7 0.17
8 0.14
9 0.12
10 0.12
11 0.11
12 0.12
13 0.12
14 0.09
15 0.14
16 0.16
17 0.17
18 0.17
19 0.18
20 0.17
21 0.17
22 0.18
23 0.15
24 0.14
25 0.14
26 0.14
27 0.14
28 0.15
29 0.13
30 0.13
31 0.1
32 0.1
33 0.09
34 0.09
35 0.09
36 0.09
37 0.11
38 0.12
39 0.14
40 0.17
41 0.23
42 0.29
43 0.31
44 0.38
45 0.4
46 0.45
47 0.46
48 0.45
49 0.47
50 0.49
51 0.55
52 0.58
53 0.65
54 0.63
55 0.69
56 0.77